Psyllid ID: psy10122

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MKTAAIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKENQHIADSC
ccccEEEEEcccccccccccccccHHccccccccccccccccccccccccccccccccccEEEEEcccccccEEcHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHHccccccEEEEEcHHHHHcHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHccccccHHHHHHHHHcccccccccccccccEEccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccEEcccEEcccccccccccHHHcccccccccHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHccccccccc
cccHEEEEEcccccccccccHHHcccccccccHHHHHHHcccccccccccHHcccccHHHHEHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHccccccccHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHcccccccHHHcccHccccEEEcccccccccHccccccccHcHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEccEEEcccccccEEEEEEcccHHHHHHHHHHHHcHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHccHcccc
MKTAAIIYVtrnpkdtcvsYYHHcqllegyrgnFEDFFKIFLDGLGTYTRDLIHCRQICNTIIyvtrnpkdtcvsYYHHcqllegyrgnFEDFFKIFLDGLVCFGPFWEHVLEFWEAskrnpenilFLKYEDMKKDLKSIIQRTGkfldhplstpdilqledhlsfesmkeNRATNYELVIEINkennlidkekcergafmrsgkigGWKALMTNEMsnqvdlwtkdnLAGYLSMVLdfepisgqstdgtrilntqfispfrtgyvrckgvcmpeyYVNFAEDIINDLKSIIQQTgkfldhplstpdilqledhlsfesmkenqhiadsc
mktaaiiyvtrnpkdtcvSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEinkennlidkekcergaFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKEnqhiadsc
MKTAAIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKENQHIADSC
****AIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQL*******************
**TAAIIYVTRNPKDTCVSYYHHCQLLEGYRG**EDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINK*NNL**KEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISG***DGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKE********
MKTAAIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESM**********
MKTAAIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKENQ*****C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTAAIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKENQHIADSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query330 2.2.26 [Sep-21-2011]
Q9M1V2323 Cytosolic sulfotransferas yes N/A 0.490 0.501 0.350 6e-23
Q8JG30296 Sulfotransferase family c yes N/A 0.484 0.540 0.348 8e-22
Q9ZPQ5324 Cytosolic sulfotransferas no N/A 0.490 0.5 0.325 2e-21
P50224295 Sulfotransferase 1A3/1A4 no N/A 0.484 0.542 0.337 2e-21
O82330333 Cytosolic sulfotransferas no N/A 0.493 0.489 0.317 2e-21
P50226295 Sulfotransferase 1A2 OS=H yes N/A 0.484 0.542 0.343 3e-21
O75897302 Sulfotransferase 1C4 OS=H no N/A 0.457 0.5 0.361 1e-20
P50225295 Sulfotransferase 1A1 OS=H yes N/A 0.484 0.542 0.337 1e-20
Q9M1V1329 Cytosolic sulfotransferas no N/A 0.478 0.480 0.329 1e-20
O46640301 Amine sulfotransferase OS yes N/A 0.454 0.498 0.373 1e-20
>sp|Q9M1V2|SOT5_ARATH Cytosolic sulfotransferase 5 OS=Arabidopsis thaliana GN=SOT5 PE=1 SV=1 Back     alignment and function desciption
 Score =  108 bits (270), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 97/171 (56%), Gaps = 9/171 (5%)

Query: 62  IIYVTRNPKDTCVSYYH---HCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEAS 118
           I+Y++RN KDT VSY+H     Q  E    +FED F++F  G+  FGPFW+HVL +W  S
Sbjct: 152 IVYISRNVKDTLVSYWHFFTKKQTDEKIISSFEDTFEMFCRGVSIFGPFWDHVLSYWRGS 211

Query: 119 KRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYE 178
             +P ++LF+K+E+MK + +  I++  +FL  P +  +    E+  S + + +  +    
Sbjct: 212 LEDPNHVLFMKFEEMKAEPRDQIKKFAEFLGCPFTKEE----EESGSVDEIIDLCSLRNL 267

Query: 179 LVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNL 229
             +EINK   L      E   F R G++G WK  +T EM N++D+  ++ L
Sbjct: 268 SSLEINKTGKL--NSGRENKMFFRKGEVGDWKNYLTPEMENKIDMIIQEKL 316
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of flavones and flavonols. Strictly specific for the position 7. Substrate preference is kaempferol 3-sulfate > isorhamnetin > kaempferol.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 8EC: .EC: 2EC: .EC: -
>sp|Q8JG30|ST1B1_CHICK Sulfotransferase family cytosolic 1B member 1 OS=Gallus gallus GN=SULT1B1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPQ5|SOT13_ARATH Cytosolic sulfotransferase 13 OS=Arabidopsis thaliana GN=SOT13 PE=3 SV=1 Back     alignment and function description
>sp|P50224|ST1A3_HUMAN Sulfotransferase 1A3/1A4 OS=Homo sapiens GN=SULT1A3 PE=1 SV=1 Back     alignment and function description
>sp|O82330|SOT10_ARATH Cytosolic sulfotransferase 10 OS=Arabidopsis thaliana GN=SOT10 PE=1 SV=1 Back     alignment and function description
>sp|P50226|ST1A2_HUMAN Sulfotransferase 1A2 OS=Homo sapiens GN=SULT1A2 PE=1 SV=2 Back     alignment and function description
>sp|O75897|ST1C4_HUMAN Sulfotransferase 1C4 OS=Homo sapiens GN=SULT1C4 PE=1 SV=2 Back     alignment and function description
>sp|P50225|ST1A1_HUMAN Sulfotransferase 1A1 OS=Homo sapiens GN=SULT1A1 PE=1 SV=3 Back     alignment and function description
>sp|Q9M1V1|SOT6_ARATH Cytosolic sulfotransferase 6 OS=Arabidopsis thaliana GN=SOT6 PE=2 SV=1 Back     alignment and function description
>sp|O46640|ST3A1_RABIT Amine sulfotransferase OS=Oryctolagus cuniculus GN=SULT3A1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
91090336321 PREDICTED: similar to sulfotransferase ( 0.496 0.510 0.558 6e-48
345483186327 PREDICTED: sulfotransferase 1C4-like [Na 0.490 0.495 0.547 3e-47
193580236328 PREDICTED: amine sulfotransferase-like [ 0.493 0.496 0.556 3e-46
242013096328 conserved hypothetical protein [Pediculu 0.490 0.493 0.529 5e-42
328783624328 PREDICTED: sulfotransferase 4A1-like [Ap 0.493 0.496 0.485 1e-39
270015380318 hypothetical protein TcasGA2_TC005277 [T 0.496 0.515 0.488 2e-39
239790272324 ACYPI005632 [Acyrthosiphon pisum] 0.503 0.512 0.476 4e-39
350415215324 PREDICTED: sulfotransferase family cytos 0.5 0.509 0.473 7e-39
340725504324 PREDICTED: sulfotransferase 4A1-like [Bo 0.5 0.509 0.461 3e-38
357618478309 hypothetical protein KGM_19409 [Danaus p 0.5 0.533 0.435 2e-37
>gi|91090336|ref|XP_966924.1| PREDICTED: similar to sulfotransferase (sult) [Tribolium castaneum] gi|270013819|gb|EFA10267.1| hypothetical protein TcasGA2_TC012467 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  197 bits (501), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 125/170 (73%), Gaps = 6/170 (3%)

Query: 62  IIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRN 121
           +IYV R+PKDTC+SY+HHC+L+EG+RG+FE+F ++FL G V FGPFW+HVL +WE  KRN
Sbjct: 153 MIYVVRDPKDTCISYFHHCKLMEGFRGDFEEFCELFLAGKVNFGPFWKHVLTYWE--KRN 210

Query: 122 PENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVI 181
             N LFLKYEDMKKDL  +I++  +FL+ PLS   +  L  HLSFESMK N A NY +V 
Sbjct: 211 SPNFLFLKYEDMKKDLSKVIRQVAQFLERPLSDEKVEILTKHLSFESMKNNPAVNYGMVC 270

Query: 182 EINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAG 231
           ++NK+  LI+ +    GAFMRSGK+GG K +M+ EM  + D W K N+ G
Sbjct: 271 DLNKKFKLIEHD----GAFMRSGKVGGHKEVMSEEMIRKFDDWIKRNVEG 316

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345483186|ref|XP_003424762.1| PREDICTED: sulfotransferase 1C4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|193580236|ref|XP_001949676.1| PREDICTED: amine sulfotransferase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242013096|ref|XP_002427251.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511584|gb|EEB14513.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328783624|ref|XP_001122579.2| PREDICTED: sulfotransferase 4A1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|270015380|gb|EFA11828.1| hypothetical protein TcasGA2_TC005277 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|239790272|dbj|BAH71707.1| ACYPI005632 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350415215|ref|XP_003490568.1| PREDICTED: sulfotransferase family cytosolic 1B member 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340725504|ref|XP_003401109.1| PREDICTED: sulfotransferase 4A1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|357618478|gb|EHJ71439.1| hypothetical protein KGM_19409 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
FB|FBgn0037665316 St2 "Sulfotransferase 2" [Dros 0.472 0.493 0.430 1.2e-33
FB|FBgn0034887338 St1 "Sulfotransferase 1" [Dros 0.524 0.511 0.393 2.3e-30
ZFIN|ZDB-GENE-060929-978311 zgc:153723 "zgc:153723" [Danio 0.481 0.511 0.410 9.4e-27
TAIR|locus:2096845323 AT3G45070 [Arabidopsis thalian 0.490 0.501 0.350 1.6e-24
TAIR|locus:2096855329 AT3G45080 [Arabidopsis thalian 0.493 0.495 0.368 6.8e-24
TAIR|locus:2044249324 AT2G03770 [Arabidopsis thalian 0.490 0.5 0.325 3.8e-23
RGD|708534299 Sult1b1 "sulfotransferase fami 0.484 0.535 0.366 6.1e-23
ZFIN|ZDB-GENE-030219-114287 sult2st1 "sulfotransferase fam 0.421 0.484 0.377 1.3e-22
UNIPROTKB|E1BJ78298 SULT1C4 "Uncharacterized prote 0.506 0.560 0.355 1.6e-22
TAIR|locus:2060505333 ST4A "sulfotransferase 4A" [Ar 0.503 0.498 0.316 2.1e-22
FB|FBgn0037665 St2 "Sulfotransferase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 366 (133.9 bits), Expect = 1.2e-33, P = 1.2e-33
 Identities = 74/172 (43%), Positives = 106/172 (61%)

Query:    62 IIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRN 121
             I+Y  RNPKD CVSYYH+ +LL G  G+FE F  +FL+G    G +W HVL FW+ S+  
Sbjct:   151 IVYTARNPKDLCVSYYHYFKLLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQ-- 208

Query:   122 PENILFLKYEDMKKDLKSIIQRTGKFL--DHPLSTPDILQLEDHLSFESMKENRATNYEL 179
              +N+LF+KYEDM KDL S+++R  +FL     L    + +L DHL+F+ M+ N+A N E 
Sbjct:   209 DDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEK 268

Query:   180 VIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAG 231
             ++           E   +  F+R+GKIG W+  M NEMS + D WT+ ++ G
Sbjct:   269 LLP----------ESSSK--FIRNGKIGDWRNHMGNEMSERFDEWTERHMRG 308
GO:0008146 "sulfotransferase activity" evidence=ISS
GO:0005829 "cytosol" evidence=NAS
GO:0051923 "sulfation" evidence=ISS
FB|FBgn0034887 St1 "Sulfotransferase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-978 zgc:153723 "zgc:153723" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2096845 AT3G45070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096855 AT3G45080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044249 AT2G03770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|708534 Sult1b1 "sulfotransferase family, cytosolic, 1B, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030219-114 sult2st1 "sulfotransferase family 2, cytosolic sulfotransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ78 SULT1C4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2060505 ST4A "sulfotransferase 4A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.8.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
pfam00685254 pfam00685, Sulfotransfer_1, Sulfotransferase domai 7e-47
PLN02164346 PLN02164, PLN02164, sulfotransferase 2e-22
pfam00685254 pfam00685, Sulfotransfer_1, Sulfotransferase domai 0.001
>gnl|CDD|216059 pfam00685, Sulfotransfer_1, Sulfotransferase domain Back     alignment and domain information 
 Score =  158 bits (402), Expect = 7e-47
 Identities = 62/173 (35%), Positives = 92/173 (53%), Gaps = 16/173 (9%)

Query: 62  IIYVTRNPKDTCVSYYHH--CQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASK 119
           IIY+ RNPKD  VSYYH      +    G   +F + FL+G V  G +++HV  +W+   
Sbjct: 95  IIYLVRNPKDVAVSYYHFFRMAKILKAPGTPFEFVEDFLNGKVNCGSYFDHVKGWWK--L 152

Query: 120 RNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYEL 179
           R P NILFL+YED+KKD +  I++  +FL  PL+  ++ ++  HLSFE+MK N   NY  
Sbjct: 153 RPPGNILFLRYEDLKKDPRGEIKKIAEFLGIPLTEEELDKIVKHLSFENMKGNPCLNYSK 212

Query: 180 VIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGY 232
           + +             E   F R G +G WK   T E + + D   ++ + G 
Sbjct: 213 LPKH------------EVSPFFRKGLVGDWKNYFTVEQAEKFDEIYQEKMKGT 253

Length = 254
>gnl|CDD|177822 PLN02164, PLN02164, sulfotransferase Back     alignment and domain information
>gnl|CDD|216059 pfam00685, Sulfotransfer_1, Sulfotransferase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 330
KOG1584|consensus297 100.0
PLN02164346 sulfotransferase 100.0
PF00685267 Sulfotransfer_1: Sulfotransferase domain; InterPro 99.91
KOG1584|consensus297 99.62
PLN02164346 sulfotransferase 99.28
PF00685267 Sulfotransfer_1: Sulfotransferase domain; InterPro 98.01
KOG3704|consensus360 97.91
KOG3703|consensus873 97.1
PF13469215 Sulfotransfer_3: Sulfotransferase family; PDB: 3AP 96.78
KOG3988|consensus378 96.62
PF09037245 Sulphotransf: Stf0 sulphotransferase; InterPro: IP 92.82
PF1406979 SpoVIF: Stage VI sporulation protein F 81.22
>KOG1584|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.7e-41  Score=308.49  Aligned_cols=173  Identities=38%  Similarity=0.700  Sum_probs=156.6

Q ss_pred             ccccccEEEEecCCCceeEEEeeeehhccC--CCCChHHHHHHHhccccccCchHHHHHHHHHHhccCCCceEEEechhh
Q psy10122         56 RQICNTIIYVTRNPKDTCVSYYHHCQLLEG--YRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDM  133 (330)
Q Consensus        56 ~~~~~KiI~i~RdPrD~~vS~~~~~~~~~~--~~~~~~~~~~~~l~g~~~~g~~~~hv~~w~~~~~~~~~~vl~v~YEdL  133 (330)
                      .+.++|+||+.|||+|++||+|||.++...  .+++++++++.|++|.+.+|+||+||++||.  +..+++||+++||||
T Consensus       121 ~~~~cKvVYv~RNpKD~~VSy~hf~~~~~~~~~~~~~e~~fe~F~~G~~~~Gp~~dHVl~~W~--~~~~~~VLFl~YEdm  198 (297)
T KOG1584|consen  121 KESKCKVVYVCRNPKDVLVSYYHFNRMLKTQPGPGTFEEFFESFCNGVVPYGPWWDHVLGYWE--LEDPKNVLFLKYEDM  198 (297)
T ss_pred             hcCCCcEEEEecCccceeeeHHHHHhhhccCCCCCcHHHHHHHHhCCcCCcCChHHHHHHHHH--hcCCCceEEEEHHHh
Confidence            567899999999999999999999988755  4567999999999999999999999999999  999999999999999


Q ss_pred             hhcHHHHHHHHHhccCCCCChhHHhhhhhcCChHHHHhhhhhhhhhHHhhhccccchhhcccccCcccccCccCCcCCCC
Q psy10122        134 KKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALM  213 (330)
Q Consensus       134 ~~dp~~~l~~i~~FLg~~~~~e~l~~iv~~~sfe~mk~~~~~n~~~~~~~~~p~~~~~~~~~~~~~f~RkG~~G~Wk~~f  213 (330)
                      ++||..++.+||+|||.++++|++++++.+.+|+.|+.++..|.+..     +.+...++   .+.|||||.+|||||||
T Consensus       199 k~dp~~~ikrlaeFLg~~~~~Ee~~~~~~~~~~~~~~~n~l~nle~n-----~~~~~~~~---~~~F~RKG~vGDWKn~~  270 (297)
T KOG1584|consen  199 KADPKGEIKKLAEFLGCPFTKEEEDKGVVHLSFELCSLNPLSNLEVN-----KTEKLLHK---ISPFFRKGEVGDWKNYL  270 (297)
T ss_pred             hhCHHHHHHHHHHHhCCCCCHHHHhhhhHHHHHHHHhhccccCceec-----cccccccc---chhhhcCCCcccccccC
Confidence            99999999999999999999999999999999999999999987653     22333343   47899999999999999


Q ss_pred             cHHHHHHHHHHHHHhhcC-CCCccccc
Q psy10122        214 TNEMSNQVDLWTKDNLAG-YLSMVLDF  239 (330)
Q Consensus       214 s~e~~~~~~~~~~~~l~~-~g~~~~~~  239 (330)
                      |++|.++||.+++++|+| +|+. |++
T Consensus       271 T~~~~ekfD~~~eekm~g~sgL~-F~~  296 (297)
T KOG1584|consen  271 TPEMNEKFDKIYEEKMEGCSGLK-FRT  296 (297)
T ss_pred             CHHHHHHHHHHHHHHhcCCCCcc-ccc
Confidence            999999999999999999 7873 544

>PLN02164 sulfotransferase Back     alignment and domain information
>PF00685 Sulfotransfer_1: Sulfotransferase domain; InterPro: IPR000863 This family includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase Back     alignment and domain information
>KOG1584|consensus Back     alignment and domain information
>PLN02164 sulfotransferase Back     alignment and domain information
>PF00685 Sulfotransfer_1: Sulfotransferase domain; InterPro: IPR000863 This family includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase Back     alignment and domain information
>KOG3704|consensus Back     alignment and domain information
>KOG3703|consensus Back     alignment and domain information
>PF13469 Sulfotransfer_3: Sulfotransferase family; PDB: 3AP1_B 3AP3_B 3AP2_B 3RNL_A 2Z6V_A 2ZQ5_A Back     alignment and domain information
>KOG3988|consensus Back     alignment and domain information
>PF09037 Sulphotransf: Stf0 sulphotransferase; InterPro: IPR024628 Members of this family are essential for the biosynthesis of sulpholipid-1 in prokaryotes Back     alignment and domain information
>PF14069 SpoVIF: Stage VI sporulation protein F Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
1x8j_A351 Crystal Structure Of Retinol Dehydratase In Complex 1e-27
1fmj_A351 Crystal Structure Of Mercury Derivative Of Retinol 4e-27
3qvu_A295 Crystal Structure Of Ancestral Variant B9 Of Sult 1 2e-23
1ls6_A295 Human Sult1a1 Complexed With Pap And P-Nitrophenol 9e-23
3u3j_A314 Crystal Structure Of Hsult1a1 Bound To Pap Length = 9e-23
3u3k_A315 Crystal Structure Of Hsult1a1 Bound To Pap And 2-Na 1e-22
1z29_A295 Crystal Structures Of Sult1a2 And Sult1a13: Implica 1e-22
1cjm_A295 Human Sult1a3 With Sulfate Bound Length = 295 1e-22
3u3r_A315 Crystal Structure Of D249g Mutated Human Sult1a1 Bo 3e-22
2ad1_A298 Human Sulfotransferase Sult1c2 Length = 298 7e-22
4gra_A299 Crystal Structure Of Sult1a1 Bound With Pap Length 8e-22
1z28_A295 Crystal Structures Of Sult1a2 And Sult1a13: Implica 1e-21
2zpt_X295 Crystal Structure Of Mouse Sulfotransferase Sult1d1 7e-21
1q44_A326 Crystal Structure Of An Arabidopsis Thaliana Putati 5e-20
1q1q_A350 Crystal Structure Of Human Pregnenolone Sulfotransf 1e-19
3ckl_A298 Crystal Structure Of Human Cytosolic Sulfotransfera 2e-19
2z5f_A298 Human Sulfotransferase Sult1b1 In Complex With Pap 2e-19
1aqu_A297 Estrogen Sulfotransferase With Bound Inactive Cofac 3e-19
1q1z_A299 Crystal Structure Of Human Cholesterol Sulfotransfe 4e-19
2h8k_A306 Human Sulfotranferase Sult1c3 In Complex With Pap L 5e-19
2reo_A305 Crystal Structure Of Human Sulfotransferase 1c3 (Su 5e-19
3bfx_A296 Crystal Structure Of Human Sulfotransferase Sult1c1 1e-18
1zd1_A284 Human Sulfortransferase Sult4a1 Length = 284 2e-18
1hy3_A294 Crystal Structure Of Human Estrogen Sulfotransferas 7e-18
1g3m_A294 Crystal Structure Of Human Estrogen Sulfotransferas 1e-17
1efh_A292 Crystal Structure Of The Human Hydroxysteroid Sulfo 2e-13
3f3y_A285 Crystal Structure Of Human Cytosolic Sulfotransfera 2e-13
1j99_A293 Crystal Structure Of Human Dehydroepiandrosterone S 2e-13
1ov4_A293 Crystal Structure Of Human Dhea-st Complexed With A 2e-13
2qp3_A284 Identification And Characterization Of Two Amino Ac 2e-13
2qp4_A284 Identification And Characterization Of Two Amino Ac 5e-13
4ifb_A285 Crystal Structure Of Sult 2a1 Llgg Mutant With Paps 2e-12
>pdb|1X8J|A Chain A, Crystal Structure Of Retinol Dehydratase In Complex With Androsterone And Inactive Cofactor Pap Length = 351 Back     alignment and structure 
Iteration: 1

 Score =  120 bits (301), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 95/170 (55%), Gaps = 12/170 (7%)
Query: 62  IIYVTRNPKDTCVSYYHHCQLLE--GYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASK 119
           ++Y+ R+P+D  VS +HH +LL     + NF+DF+++F  GL    P++EHV E W  +K
Sbjct: 180 MVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAW--AK 237
Query: 120 RNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYEL 179
           R+  N+LFL YED  KDL   I R   FL   LS   I +L +HL+FE  K N A N E 
Sbjct: 238 RHDPNMLFLFYEDYLKDLPGSIARIADFLGKKLSEEQIQRLSEHLNFEKFKNNGAVNMED 297
Query: 180 VIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNL 229
             EI     L D E      F+R GK G W+     EM+ Q + W KDNL
Sbjct: 298 YREIGI---LADGEH-----FIRKGKAGCWRDYFDEEMTKQAEKWIKDNL 339
>pdb|1FMJ|A Chain A, Crystal Structure Of Mercury Derivative Of Retinol Dehydratase In A Complex With Retinol And Pap Length = 351 Back     alignment and structure
>pdb|3QVU|A Chain A, Crystal Structure Of Ancestral Variant B9 Of Sult 1a1 In Complex With Pap And P-Nitrophenol Length = 295 Back     alignment and structure
>pdb|1LS6|A Chain A, Human Sult1a1 Complexed With Pap And P-Nitrophenol Length = 295 Back     alignment and structure
>pdb|3U3J|A Chain A, Crystal Structure Of Hsult1a1 Bound To Pap Length = 314 Back     alignment and structure
>pdb|3U3K|A Chain A, Crystal Structure Of Hsult1a1 Bound To Pap And 2-Naphtol Length = 315 Back     alignment and structure
>pdb|1Z29|A Chain A, Crystal Structures Of Sult1a2 And Sult1a13: Implications In The Bioactivation Of N-Hydroxy-2-Acetylamino Fluorine (Oh-Aaf) Length = 295 Back     alignment and structure
>pdb|1CJM|A Chain A, Human Sult1a3 With Sulfate Bound Length = 295 Back     alignment and structure
>pdb|3U3R|A Chain A, Crystal Structure Of D249g Mutated Human Sult1a1 Bound To Pap And P- Nitrophenol Length = 315 Back     alignment and structure
>pdb|2AD1|A Chain A, Human Sulfotransferase Sult1c2 Length = 298 Back     alignment and structure
>pdb|4GRA|A Chain A, Crystal Structure Of Sult1a1 Bound With Pap Length = 299 Back     alignment and structure
>pdb|1Z28|A Chain A, Crystal Structures Of Sult1a2 And Sult1a13: Implications In The Bioactivation Of N-Hydroxy-2-Acetylamino Fluorine (Oh-Aaf) Length = 295 Back     alignment and structure
>pdb|2ZPT|X Chain X, Crystal Structure Of Mouse Sulfotransferase Sult1d1 Complex With Pap Length = 295 Back     alignment and structure
>pdb|1Q44|A Chain A, Crystal Structure Of An Arabidopsis Thaliana Putative Steroid Sulfotransferase Length = 326 Back     alignment and structure
>pdb|1Q1Q|A Chain A, Crystal Structure Of Human Pregnenolone Sulfotransferase (Sult2b1a) In The Presence Of Pap Length = 350 Back     alignment and structure
>pdb|3CKL|A Chain A, Crystal Structure Of Human Cytosolic Sulfotransferase Sult1b1 In Complex With Pap And Resveratrol Length = 298 Back     alignment and structure
>pdb|2Z5F|A Chain A, Human Sulfotransferase Sult1b1 In Complex With Pap Length = 298 Back     alignment and structure
>pdb|1AQU|A Chain A, Estrogen Sulfotransferase With Bound Inactive Cofactor Pap And 17-Beta Estradiol Length = 297 Back     alignment and structure
>pdb|1Q1Z|A Chain A, Crystal Structure Of Human Cholesterol Sulfotransferase (Sult2b1b) In The Presence Of Pap Length = 299 Back     alignment and structure
>pdb|2H8K|A Chain A, Human Sulfotranferase Sult1c3 In Complex With Pap Length = 306 Back     alignment and structure
>pdb|2REO|A Chain A, Crystal Structure Of Human Sulfotransferase 1c3 (Sult1c3) In Complex With Pap Length = 305 Back     alignment and structure
>pdb|3BFX|A Chain A, Crystal Structure Of Human Sulfotransferase Sult1c1 In Complex With Pap Length = 296 Back     alignment and structure
>pdb|1ZD1|A Chain A, Human Sulfortransferase Sult4a1 Length = 284 Back     alignment and structure
>pdb|1HY3|A Chain A, Crystal Structure Of Human Estrogen Sulfotransferase V269e Mutant In The Presence Of Paps Length = 294 Back     alignment and structure
>pdb|1G3M|A Chain A, Crystal Structure Of Human Estrogen Sulfotransferase In Complex With In-Active Cofactor Pap And 3,5,3',5'- Tetrachloro-Biphenyl-4,4'-Diol Length = 294 Back     alignment and structure
>pdb|1EFH|A Chain A, Crystal Structure Of The Human Hydroxysteroid Sulfotransferase In The Presence Of Pap Length = 292 Back     alignment and structure
>pdb|3F3Y|A Chain A, Crystal Structure Of Human Cytosolic Sulfotransferase Sult2a1 In Complex With Pap And Lithocholic Acid Length = 285 Back     alignment and structure
>pdb|1J99|A Chain A, Crystal Structure Of Human Dehydroepiandrosterone Sulfotransferase In Complex With Substrate Length = 293 Back     alignment and structure
>pdb|1OV4|A Chain A, Crystal Structure Of Human Dhea-st Complexed With Androsterone Length = 293 Back     alignment and structure
>pdb|2QP3|A Chain A, Identification And Characterization Of Two Amino Acids Critical For The Substrate Inhibition Of Sult2a1 Length = 284 Back     alignment and structure
>pdb|2QP4|A Chain A, Identification And Characterization Of Two Amino Acids Critical For The Substrate Inhibition Of Sult2a1 Length = 284 Back     alignment and structure
>pdb|4IFB|A Chain A, Crystal Structure Of Sult 2a1 Llgg Mutant With Paps Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
3bfx_A296 Sulfotransferase 1C2; PAP, structural genomics, PS 2e-61
3bfx_A296 Sulfotransferase 1C2; PAP, structural genomics, PS 4e-04
1q44_A326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 5e-61
1q44_A326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 8e-05
1j99_A293 Alcohol sulfotransferase; dehydroepiandosterone, D 2e-60
1j99_A293 Alcohol sulfotransferase; dehydroepiandosterone, D 3e-06
2reo_A305 Putative sulfotransferase 1C3; sulfate conjugation 4e-60
2reo_A305 Putative sulfotransferase 1C3; sulfate conjugation 4e-04
2gwh_A298 Sulfotransferase 1C2; sulfate conjugation, pentach 6e-60
2gwh_A298 Sulfotransferase 1C2; sulfate conjugation, pentach 1e-05
1q1q_A350 SULT2B1A, sulfotransferase family, cytosolic, 2B, 2e-59
1q1q_A 350 SULT2B1A, sulfotransferase family, cytosolic, 2B, 2e-04
2zpt_X295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 2e-59
2zpt_X295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 1e-04
1aqu_A297 EST, estrogen sulfotransferase; PAP, sulfonation, 2e-59
1aqu_A297 EST, estrogen sulfotransferase; PAP, sulfonation, 1e-04
1q20_A299 SULT2B1B, sulfotransferase family, cytosolic, 2B, 3e-59
1q20_A299 SULT2B1B, sulfotransferase family, cytosolic, 2B, 2e-04
1fmj_A351 Retinol dehydratase; sulfotransferase, adenosine 3 3e-59
1fmj_A351 Retinol dehydratase; sulfotransferase, adenosine 3 8e-06
1ls6_A295 ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno 2e-57
1ls6_A295 ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno 2e-04
3ckl_A298 Sulfotransferase family cytosolic 1B member 1; SUL 2e-56
3ckl_A298 Sulfotransferase family cytosolic 1B member 1; SUL 1e-04
1zd1_A284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 1e-53
1zd1_A284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 5e-04
3mgb_A319 TEG12; sulfotransferase, glycopeptide, antibiotic, 1e-52
3mgb_A319 TEG12; sulfotransferase, glycopeptide, antibiotic, 6e-04
2ov8_A288 STAL; sulfotransferase, structural genomics, montr 2e-49
2ov8_A288 STAL; sulfotransferase, structural genomics, montr 6e-04
3uan_A269 Heparan sulfate glucosamine 3-O-sulfotransferase; 4e-07
2z6v_A414 Putative uncharacterized protein; sulfotransferase 5e-07
1nst_A325 NST1, heparan sulfate N-deacetylase/N-sulfotransfe 6e-07
3ap1_A337 Protein-tyrosine sulfotransferase 2; sulfotransfer 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3rnl_A311 Sulfotransferase; structural genomics, PSI-biology 7e-06
2zq5_A384 Putative uncharacterized protein; sulfotransferase 4e-05
3bd9_A280 Heparan sulfate glucosamine 3-O-sulfotransferase 5 7e-04
>3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Length = 296 Back     alignment and structure
 Score =  196 bits (501), Expect = 2e-61
 Identities = 56/182 (30%), Positives = 91/182 (50%), Gaps = 13/182 (7%)

Query: 61  TIIYVTRNPKDTCVSYYHHCQLL--EGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEAS 118
             +YV RN KD  VSYYH  ++       G +E++F+ F++G V +G +++HV  +WE  
Sbjct: 125 KFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWE-- 182

Query: 119 KRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYE 178
            ++   ILFL YED+K+D K  I++  +F+   +    + ++    SFE MKEN  TN  
Sbjct: 183 MKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRS 242

Query: 179 LVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLD 238
            V +   +            +FMR G +G WK   T   + + D   +  + G  S+   
Sbjct: 243 TVSKSILDQ--------SISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGT-SINFS 293

Query: 239 FE 240
            E
Sbjct: 294 ME 295
>3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Length = 296 Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Length = 326 Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Length = 326 Back     alignment and structure
>1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Length = 293 Back     alignment and structure
>1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Length = 293 Back     alignment and structure
>2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Length = 305 Back     alignment and structure
>2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Length = 305 Back     alignment and structure
>2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Length = 298 Back     alignment and structure
>2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Length = 298 Back     alignment and structure
>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Length = 350 Back     alignment and structure
>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Length = 350 Back     alignment and structure
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Length = 295 Back     alignment and structure
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Length = 295 Back     alignment and structure
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Length = 297 Back     alignment and structure
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Length = 297 Back     alignment and structure
>1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Length = 299 Back     alignment and structure
>1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Length = 299 Back     alignment and structure
>1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Length = 351 Back     alignment and structure
>1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Length = 351 Back     alignment and structure
>1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Length = 295 Back     alignment and structure
>1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Length = 295 Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Length = 298 Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Length = 298 Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Length = 284 Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Length = 284 Back     alignment and structure
>3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Length = 319 Back     alignment and structure
>3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Length = 319 Back     alignment and structure
>2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* Length = 288 Back     alignment and structure
>2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* Length = 288 Back     alignment and structure
>3uan_A Heparan sulfate glucosamine 3-O-sulfotransferase; alpha/beta motif, CO-FACT PAPS/PAP, heparan sulfate oligosaccharides, golgi-localized transferase; HET: A3P NGY BDP SGN IDS; 1.84A {Mus musculus} PDB: 1vkj_A* 1zrh_A* Length = 269 Back     alignment and structure
>2z6v_A Putative uncharacterized protein; sulfotransferase, unknown function; HET: PLM; 2.60A {Mycobacterium avium} Length = 414 Back     alignment and structure
>1nst_A NST1, heparan sulfate N-deacetylase/N-sulfotransferase; PAP, haparin sulfate, haparin sulfate biosynthesis, glycoprotein; HET: A3P; 2.30A {Homo sapiens} SCOP: c.37.1.5 Length = 325 Back     alignment and structure
>3ap1_A Protein-tyrosine sulfotransferase 2; sulfotransferase fold, transferase; HET: A3P; 1.90A {Homo sapiens} PDB: 3ap2_A* 3ap3_A* Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rnl_A Sulfotransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.75A {Alicyclobacillus acidocaldarius subsp} Length = 311 Back     alignment and structure
>2zq5_A Putative uncharacterized protein; sulfotransferase fold; 2.00A {Mycobacterium tuberculosis} Length = 384 Back     alignment and structure
>3bd9_A Heparan sulfate glucosamine 3-O-sulfotransferase 5; heparan sulfate biosynthesis, substrate specificity, glycoprotein, golgi apparatus, membrane; HET: A3P; 2.30A {Homo sapiens} Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
1aqu_A297 EST, estrogen sulfotransferase; PAP, sulfonation, 100.0
2zpt_X295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 100.0
3ckl_A298 Sulfotransferase family cytosolic 1B member 1; SUL 100.0
1ls6_A295 ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno 100.0
2reo_A305 Putative sulfotransferase 1C3; sulfate conjugation 100.0
2gwh_A298 Sulfotransferase 1C2; sulfate conjugation, pentach 100.0
1fmj_A351 Retinol dehydratase; sulfotransferase, adenosine 3 100.0
3bfx_A296 Sulfotransferase 1C2; PAP, structural genomics, PS 100.0
1q20_A299 SULT2B1B, sulfotransferase family, cytosolic, 2B, 100.0
1q1q_A350 SULT2B1A, sulfotransferase family, cytosolic, 2B, 100.0
1j99_A293 Alcohol sulfotransferase; dehydroepiandosterone, D 100.0
3mgb_A319 TEG12; sulfotransferase, glycopeptide, antibiotic, 99.98
1q44_A326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 99.97
1zd1_A284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 99.97
2ov8_A288 STAL; sulfotransferase, structural genomics, montr 99.97
3ap1_A337 Protein-tyrosine sulfotransferase 2; sulfotransfer 99.76
1t8t_A271 Heparan sulfate D-glucosaminyl 3-O- sulfotransfera 99.69
4gox_A313 Polyketide synthase; olefin synthase, hydrocarbon, 99.6
4gbm_A323 CURM sulfotransferase; polyketide synthase, curaci 99.54
3bd9_A280 Heparan sulfate glucosamine 3-O-sulfotransferase 5 99.52
3rnl_A311 Sulfotransferase; structural genomics, PSI-biology 99.49
3uan_A269 Heparan sulfate glucosamine 3-O-sulfotransferase; 99.46
1nst_A325 NST1, heparan sulfate N-deacetylase/N-sulfotransfe 99.45
2zq5_A384 Putative uncharacterized protein; sulfotransferase 99.36
2z6v_A414 Putative uncharacterized protein; sulfotransferase 99.35
1aqu_A297 EST, estrogen sulfotransferase; PAP, sulfonation, 99.3
1fmj_A351 Retinol dehydratase; sulfotransferase, adenosine 3 99.25
3bfx_A296 Sulfotransferase 1C2; PAP, structural genomics, PS 99.23
2zpt_X295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 99.23
2gwh_A298 Sulfotransferase 1C2; sulfate conjugation, pentach 99.22
2reo_A305 Putative sulfotransferase 1C3; sulfate conjugation 99.22
3ckl_A298 Sulfotransferase family cytosolic 1B member 1; SUL 99.2
1j99_A293 Alcohol sulfotransferase; dehydroepiandosterone, D 99.2
3mgb_A319 TEG12; sulfotransferase, glycopeptide, antibiotic, 99.2
1q20_A299 SULT2B1B, sulfotransferase family, cytosolic, 2B, 99.18
1ls6_A295 ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno 99.17
1q1q_A 350 SULT2B1A, sulfotransferase family, cytosolic, 2B, 99.13
2ov8_A288 STAL; sulfotransferase, structural genomics, montr 99.11
1q44_A326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 98.99
1zd1_A284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 98.81
1tex_A287 STF0 sulfotransferase; sulfolipid, sulfation, TREH 98.08
3rnl_A311 Sulfotransferase; structural genomics, PSI-biology 97.92
3uan_A269 Heparan sulfate glucosamine 3-O-sulfotransferase; 97.77
1t8t_A271 Heparan sulfate D-glucosaminyl 3-O- sulfotransfera 97.62
2zq5_A384 Putative uncharacterized protein; sulfotransferase 97.43
3bd9_A280 Heparan sulfate glucosamine 3-O-sulfotransferase 5 97.18
1nst_A325 NST1, heparan sulfate N-deacetylase/N-sulfotransfe 97.12
2z6v_A414 Putative uncharacterized protein; sulfotransferase 96.4
3ap1_A337 Protein-tyrosine sulfotransferase 2; sulfotransfer 96.4
4gox_A313 Polyketide synthase; olefin synthase, hydrocarbon, 94.83
4gbm_A323 CURM sulfotransferase; polyketide synthase, curaci 94.83
1tex_A287 STF0 sulfotransferase; sulfolipid, sulfation, TREH 86.35
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-35  Score=275.77  Aligned_cols=172  Identities=30%  Similarity=0.597  Sum_probs=152.2

Q ss_pred             ccccEEEEecCCCceeEEEeeeehhcc--CCCCChHHHHHHHhccccccCchHHHHHHHHHHhccCCCceEEEechhhhh
Q psy10122         58 ICNTIIYVTRNPKDTCVSYYHHCQLLE--GYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKK  135 (330)
Q Consensus        58 ~~~KiI~i~RdPrD~~vS~~~~~~~~~--~~~~~~~~~~~~~l~g~~~~g~~~~hv~~w~~~~~~~~~~vl~v~YEdL~~  135 (330)
                      +++|+||++|||+|++||+|+|.....  ...++++++++.++.|...+|+|++|+.+||+  .+.+++|++++||||++
T Consensus       123 ~~~KiI~v~RnP~D~~vS~y~~~~~~~~~~~~~~~~~~~~~~~~g~~~~g~~~~h~~~~~~--~~~~~~vl~l~YEdL~~  200 (297)
T 1aqu_A          123 KNCKMIYLCRNAKDVAVSYYYFLLMITSYPNPKSFSEFVEKFMQGQVPYGSWYDHVKAWWE--KSKNSRVLFMFYEDMKE  200 (297)
T ss_dssp             TTCEEEEEECCHHHHHHHHHHHHHHBTTSCCCSCHHHHHHHHHHTCSTTCCHHHHHHHHHH--HTTSTTEEEEEHHHHHH
T ss_pred             CCceEEEEEecchHHeeehhHHhhccccCCCCCCHHHHHHHHhCCCcccccHHHHHHHHHH--hcccCCeEEEEhhhhhh
Confidence            789999999999999999999876543  24678999999999998889999999999999  77889999999999999


Q ss_pred             cHHHHHHHHHhccCCCCChhHHhhhhhcCChHHHHhhhhhhhhhHHhhhccccchhhcccccCcccccCccCCcCCCCcH
Q psy10122        136 DLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTN  215 (330)
Q Consensus       136 dp~~~l~~i~~FLg~~~~~e~l~~iv~~~sfe~mk~~~~~n~~~~~~~~~p~~~~~~~~~~~~~f~RkG~~G~Wk~~fs~  215 (330)
                      ||.+++++|++|||+++++++++++++++||++||+++..|.+..     |..+.+..   .+.|+|||++|+|||+||+
T Consensus       201 dp~~~~~~i~~FLG~~~~~~~l~~iv~~~sf~~mk~~~~~~~~~~-----~~~~~~~~---~~~f~RkG~~GdWk~~lt~  272 (297)
T 1aqu_A          201 DIRREVVKLIEFLERKPSAELVDRIIQHTSFQEMKNNPSTNYTMM-----PEEMMNQK---VSPFMRKGIIGDWKNHFPE  272 (297)
T ss_dssp             CHHHHHHHHHHHTTCCCCHHHHHHHHHHTSHHHHHHCTTTTTTTS-----CTTTBCTT---TSCSSCCCCSCGGGGTCCH
T ss_pred             hHHHHHHHHHHHcCCCCCHHHHHHHHHhCCHHHHHhchhcccccc-----chhhhccc---ccceeeCCCCCCCccCCCH
Confidence            999999999999999999999999999999999999987765432     11222222   5779999999999999999


Q ss_pred             HHHHHHHHHHHHhhcCCCCcccccc
Q psy10122        216 EMSNQVDLWTKDNLAGYLSMVLDFE  240 (330)
Q Consensus       216 e~~~~~~~~~~~~l~~~g~~~~~~~  240 (330)
                      +|+++|+++++++|+++|+. |.|+
T Consensus       273 e~~~~~~~~~~~~l~~~g~~-f~~~  296 (297)
T 1aqu_A          273 ALRERFDEHYKQQMKDCTVK-FRME  296 (297)
T ss_dssp             HHHHHHHHHHHHHHTTCCCC-CCCC
T ss_pred             HHHHHHHHHHHHHhcCCCCc-cccC
Confidence            99999999999999999996 6664
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Back     alignment and structure
>1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Back     alignment and structure
>2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Back     alignment and structure
>2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Back     alignment and structure
>1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Back     alignment and structure
>3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Back     alignment and structure
>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Back     alignment and structure
>3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Back     alignment and structure
>2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* Back     alignment and structure
>3ap1_A Protein-tyrosine sulfotransferase 2; sulfotransferase fold, transferase; HET: A3P; 1.90A {Homo sapiens} PDB: 3ap2_A* 3ap3_A* Back     alignment and structure
>1t8t_A Heparan sulfate D-glucosaminyl 3-O- sulfotransferase 3A1; alpha-beta motif, substrate-binding cleft; HET: A3P CIT; 1.85A {Homo sapiens} SCOP: c.37.1.5 PDB: 1t8u_A* Back     alignment and structure
>4gox_A Polyketide synthase; olefin synthase, hydrocarbon, sulfotran PAPS, PAP, 3'phosphoadenosine-5'phosphosulfate, transferase; HET: A3P; 2.15A {Synechococcus SP} Back     alignment and structure
>4gbm_A CURM sulfotransferase; polyketide synthase, curacin, PAP, PAPS; HET: A3P P6G; 1.62A {Moorea producta} Back     alignment and structure
>3bd9_A Heparan sulfate glucosamine 3-O-sulfotransferase 5; heparan sulfate biosynthesis, substrate specificity, glycoprotein, golgi apparatus, membrane; HET: A3P; 2.30A {Homo sapiens} Back     alignment and structure
>3rnl_A Sulfotransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.75A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3uan_A Heparan sulfate glucosamine 3-O-sulfotransferase; alpha/beta motif, CO-FACT PAPS/PAP, heparan sulfate oligosaccharides, golgi-localized transferase; HET: A3P NGY BDP SGN IDS; 1.84A {Mus musculus} PDB: 1vkj_A* 1zrh_A* Back     alignment and structure
>1nst_A NST1, heparan sulfate N-deacetylase/N-sulfotransferase; PAP, haparin sulfate, haparin sulfate biosynthesis, glycoprotein; HET: A3P; 2.30A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>2zq5_A Putative uncharacterized protein; sulfotransferase fold; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2z6v_A Putative uncharacterized protein; sulfotransferase, unknown function; HET: PLM; 2.60A {Mycobacterium avium} Back     alignment and structure
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Back     alignment and structure
>1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Back     alignment and structure
>3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Back     alignment and structure
>2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Back     alignment and structure
>2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Back     alignment and structure
>1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Back     alignment and structure
>3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Back     alignment and structure
>1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Back     alignment and structure
>1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Back     alignment and structure
>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Back     alignment and structure
>1tex_A STF0 sulfotransferase; sulfolipid, sulfation, TREH trehalose-2-sulfate; HET: TRE; 2.60A {Mycobacterium smegmatis} SCOP: c.37.1.5 Back     alignment and structure
>3rnl_A Sulfotransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.75A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3uan_A Heparan sulfate glucosamine 3-O-sulfotransferase; alpha/beta motif, CO-FACT PAPS/PAP, heparan sulfate oligosaccharides, golgi-localized transferase; HET: A3P NGY BDP SGN IDS; 1.84A {Mus musculus} PDB: 1vkj_A* 1zrh_A* Back     alignment and structure
>1t8t_A Heparan sulfate D-glucosaminyl 3-O- sulfotransferase 3A1; alpha-beta motif, substrate-binding cleft; HET: A3P CIT; 1.85A {Homo sapiens} SCOP: c.37.1.5 PDB: 1t8u_A* Back     alignment and structure
>2zq5_A Putative uncharacterized protein; sulfotransferase fold; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3bd9_A Heparan sulfate glucosamine 3-O-sulfotransferase 5; heparan sulfate biosynthesis, substrate specificity, glycoprotein, golgi apparatus, membrane; HET: A3P; 2.30A {Homo sapiens} Back     alignment and structure
>1nst_A NST1, heparan sulfate N-deacetylase/N-sulfotransferase; PAP, haparin sulfate, haparin sulfate biosynthesis, glycoprotein; HET: A3P; 2.30A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>2z6v_A Putative uncharacterized protein; sulfotransferase, unknown function; HET: PLM; 2.60A {Mycobacterium avium} Back     alignment and structure
>3ap1_A Protein-tyrosine sulfotransferase 2; sulfotransferase fold, transferase; HET: A3P; 1.90A {Homo sapiens} PDB: 3ap2_A* 3ap3_A* Back     alignment and structure
>4gox_A Polyketide synthase; olefin synthase, hydrocarbon, sulfotran PAPS, PAP, 3'phosphoadenosine-5'phosphosulfate, transferase; HET: A3P; 2.15A {Synechococcus SP} Back     alignment and structure
>4gbm_A CURM sulfotransferase; polyketide synthase, curacin, PAP, PAPS; HET: A3P P6G; 1.62A {Moorea producta} Back     alignment and structure
>1tex_A STF0 sulfotransferase; sulfolipid, sulfation, TREH trehalose-2-sulfate; HET: TRE; 2.60A {Mycobacterium smegmatis} SCOP: c.37.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 330
d3bfxa1285 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Huma 4e-30
d1q44a_320 c.37.1.5 (A:) Putative steroid sulfotransferase ra 6e-29
d1ls6a_288 c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human 7e-29
d1j99a_284 c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult 8e-29
d2z5fa_293 c.37.1.5 (A:) Thyroid hormone sulfotransferase Sul 8e-28
d1g3ma_290 c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult 1e-25
d1q20a_294 c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1 1e-21
d1fmja_342 c.37.1.5 (A:) Retinol dehydratase {Fall armyworm ( 3e-21
d1nsta_301 c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulf 3e-09
d1t8ta_271 c.37.1.5 (A:) Heparan sulfate glucosamine 3-O-sulf 2e-08
d1texa_265 c.37.1.5 (A:) Stf0 sulfotransferase {Mycobacterium 3e-07
d1vkja_258 c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase 1e-06
>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: PAPS sulfotransferase
domain: Sulfotransferase Sult1c2
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  113 bits (284), Expect = 4e-30
 Identities = 54/180 (30%), Positives = 90/180 (50%), Gaps = 12/180 (6%)

Query: 54  HCRQICNTIIYVTRNPKDTCVSYYHHCQLL--EGYRGNFEDFFKIFLDGLVCFGPFWEHV 111
              +     +YV RN KD  VSYYH  ++       G +E++F+ F++G V +G +++HV
Sbjct: 107 SFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHV 166

Query: 112 LEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKE 171
             +WE   ++   ILFL YED+K+D K  I++  +F+   +    + ++    SFE MKE
Sbjct: 167 KGWWEM--KDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKE 224

Query: 172 NRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAG 231
           N  TN   V +   + +          +FMR G +G WK   T   + + D   +  + G
Sbjct: 225 NPMTNRSTVSKSILDQS--------ISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEG 276
>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure
>d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure
>d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Length = 342 Back     information, alignment and structure
>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 301 Back     information, alignment and structure
>d1t8ta_ c.37.1.5 (A:) Heparan sulfate glucosamine 3-O-sulfotransferase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1texa_ c.37.1.5 (A:) Stf0 sulfotransferase {Mycobacterium smegmatis [TaxId: 1772]} Length = 265 Back     information, alignment and structure
>d1vkja_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
d3bfxa1285 Sulfotransferase Sult1c2 {Human (Homo sapiens) [Ta 100.0
d2z5fa_293 Thyroid hormone sulfotransferase Sult1b1 {Human (H 100.0
d1ls6a_288 Aryl sulfotransferase sult1a {Human (Homo sapiens) 100.0
d1q44a_320 Putative steroid sulfotransferase rarO47 {Thale cr 100.0
d1j99a_284 Hydroxysteroid sulfotransferase sult2a1 {Human (Ho 100.0
d1fmja_342 Retinol dehydratase {Fall armyworm (Spodoptera fru 100.0
d1g3ma_290 Estrogen sulfotransferase (STE, sult1e1) {Human (H 100.0
d1q20a_294 Cholesterol sulfotransferase sult2b1b {Human (Homo 100.0
d1t8ta_271 Heparan sulfate glucosamine 3-O-sulfotransferase 3 99.35
d1vkja_258 Heparan sulfate 3-O-sulfotransferase {Mouse (Mus m 99.33
d1nsta_301 Heparan sulfate N-deacetylase/N-sulfotransferase d 99.17
d3bfxa1285 Sulfotransferase Sult1c2 {Human (Homo sapiens) [Ta 99.12
d1ls6a_288 Aryl sulfotransferase sult1a {Human (Homo sapiens) 99.1
d1fmja_342 Retinol dehydratase {Fall armyworm (Spodoptera fru 99.08
d1j99a_284 Hydroxysteroid sulfotransferase sult2a1 {Human (Ho 99.05
d2z5fa_293 Thyroid hormone sulfotransferase Sult1b1 {Human (H 99.04
d1q44a_320 Putative steroid sulfotransferase rarO47 {Thale cr 98.9
d1g3ma_290 Estrogen sulfotransferase (STE, sult1e1) {Human (H 98.86
d1q20a_294 Cholesterol sulfotransferase sult2b1b {Human (Homo 98.83
d1texa_265 Stf0 sulfotransferase {Mycobacterium smegmatis [Ta 98.49
d1texa_265 Stf0 sulfotransferase {Mycobacterium smegmatis [Ta 94.17
d1t8ta_271 Heparan sulfate glucosamine 3-O-sulfotransferase 3 93.89
d1vkja_258 Heparan sulfate 3-O-sulfotransferase {Mouse (Mus m 92.73
d1nsta_301 Heparan sulfate N-deacetylase/N-sulfotransferase d 92.5
>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: PAPS sulfotransferase
domain: Sulfotransferase Sult1c2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.2e-37  Score=283.40  Aligned_cols=174  Identities=32%  Similarity=0.592  Sum_probs=145.3

Q ss_pred             cccccEEEEecCCCceeEEEeeeehhccC--CCCChHHHHHHHhccccccCchHHHHHHHHHHhccCCCceEEEechhhh
Q psy10122         57 QICNTIIYVTRNPKDTCVSYYHHCQLLEG--YRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMK  134 (330)
Q Consensus        57 ~~~~KiI~i~RdPrD~~vS~~~~~~~~~~--~~~~~~~~~~~~l~g~~~~g~~~~hv~~w~~~~~~~~~~vl~v~YEdL~  134 (330)
                      .+++|+||++|||+|++||+|||......  .+++++++++.+..|...+|+|++|+.+|+.  ....++|++++||||+
T Consensus       110 ~~~~kiI~ivRdPrDv~vS~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~w~~h~~sW~~--~~~~~~vl~irYEdL~  187 (285)
T d3bfxa1         110 ENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWE--MKDRHQILFLFYEDIK  187 (285)
T ss_dssp             HTTCEEEEEECCHHHHHHHHHHHHHHCTTSCCCCSHHHHHHHHHTTCSBTCCHHHHHHHHHH--HTTTSEEEEEEHHHHH
T ss_pred             cccceEEEeccChHHHHhhHHHHHhhhhcccCccCHHHHHHHhccCccccccccccchhHHh--ccCCCCeeEeeHhHHh
Confidence            46899999999999999999988765543  5678999999999888889999999999999  8888999999999999


Q ss_pred             hcHHHHHHHHHhccCCCCChhHHhhhhhcCChHHHHhhhhhhhhhHHhhhccccchhhcccccCcccccCccCCcCCCCc
Q psy10122        135 KDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMT  214 (330)
Q Consensus       135 ~dp~~~l~~i~~FLg~~~~~e~l~~iv~~~sfe~mk~~~~~n~~~~~~~~~p~~~~~~~~~~~~~f~RkG~~G~Wk~~fs  214 (330)
                      +||.+++++|++|||++++++.+++|+++|||++||+++..+...+.+.     ..+.+   .++|||||++|+|||+||
T Consensus       188 ~d~~~~v~kI~~FLg~~~~~~~i~~i~~~~sF~~mk~~e~~~~~~~~~~-----~~~~~---~~~FfRkG~~G~Wk~~~s  259 (285)
T d3bfxa1         188 RDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKS-----ILDQS---ISSFMRKGTVGDWKNHFT  259 (285)
T ss_dssp             HCHHHHHHHHHHHTTCCCCHHHHHHHHHHTSHHHHHHC---------------------------CCCCCCSCTHHHHCC
T ss_pred             hhHHHHHHHHHHhhcccccHHHHHHHHHHcCHHHHHhhHHhcccccccc-----cccCC---CCCeeeCCCCCCchhhCC
Confidence            9999999999999999999999999999999999999887765443221     12222   678999999999999999


Q ss_pred             HHHHHHHHHHHHHhhcCCCCccccccc
Q psy10122        215 NEMSNQVDLWTKDNLAGYLSMVLDFEP  241 (330)
Q Consensus       215 ~e~~~~~~~~~~~~l~~~g~~~~~~~~  241 (330)
                      ++|+++|+++++++|+|+|+. |+||+
T Consensus       260 ~eq~~~~~~~~~e~m~~~~~~-f~~e~  285 (285)
T d3bfxa1         260 VAQNERFDEIYRRKMEGTSIN-FSMEL  285 (285)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCC-CCCCC
T ss_pred             HHHHHHHHHHHHHHhCCCCCc-eeccC
Confidence            999999999999999999987 88874
>d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t8ta_ c.37.1.5 (A:) Heparan sulfate glucosamine 3-O-sulfotransferase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkja_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1texa_ c.37.1.5 (A:) Stf0 sulfotransferase {Mycobacterium smegmatis [TaxId: 1772]} Back     information, alignment and structure
>d1texa_ c.37.1.5 (A:) Stf0 sulfotransferase {Mycobacterium smegmatis [TaxId: 1772]} Back     information, alignment and structure
>d1t8ta_ c.37.1.5 (A:) Heparan sulfate glucosamine 3-O-sulfotransferase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkja_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure