Diaphorina citri psyllid: psy10123


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKLQDGSTKAKGR
ccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHcccccHHHHHHHHHcccccccccccccccEEcccccccccccccHHHHHHHHHcccccccccccccccccHcccccccccc
*LSVH*DLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKLQ*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKLQDGSTKAKGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008146 [MF]sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0003674
GO:0051923 [BP]sulfationprobableGO:0008150, GO:0009987, GO:0006790, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZPT, chain X
Confidence level:very confident
Coverage over the Query: 1-104
View the alignment between query and template
View the model in PyMOL
Template: 2ZPT, chain X
Confidence level:very confident
Coverage over the Query: 93-121
View the alignment between query and template
View the model in PyMOL