Psyllid ID: psy10123
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| 193580236 | 328 | PREDICTED: amine sulfotransferase-like [ | 0.569 | 0.213 | 0.608 | 3e-16 | |
| 91090336 | 321 | PREDICTED: similar to sulfotransferase ( | 0.569 | 0.218 | 0.486 | 1e-10 | |
| 345483186 | 327 | PREDICTED: sulfotransferase 1C4-like [Na | 0.634 | 0.238 | 0.463 | 4e-10 | |
| 350415215 | 324 | PREDICTED: sulfotransferase family cytos | 0.764 | 0.290 | 0.404 | 3e-08 | |
| 270015380 | 318 | hypothetical protein TcasGA2_TC005277 [T | 0.593 | 0.229 | 0.441 | 5e-08 | |
| 242013096 | 328 | conserved hypothetical protein [Pediculu | 0.560 | 0.210 | 0.452 | 7e-08 | |
| 340725504 | 324 | PREDICTED: sulfotransferase 4A1-like [Bo | 0.780 | 0.296 | 0.376 | 4e-07 | |
| 357618478 | 309 | hypothetical protein KGM_19409 [Danaus p | 0.658 | 0.262 | 0.333 | 1e-06 | |
| 328783624 | 328 | PREDICTED: sulfotransferase 4A1-like [Ap | 0.544 | 0.204 | 0.450 | 1e-06 | |
| 47210634 | 252 | unnamed protein product [Tetraodon nigro | 0.520 | 0.253 | 0.402 | 1e-05 |
| >gi|193580236|ref|XP_001949676.1| PREDICTED: amine sulfotransferase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 89.0 bits (219), Expect = 3e-16, Method: Compositional matrix adjust.
Identities = 45/74 (60%), Positives = 55/74 (74%), Gaps = 4/74 (5%)
Query: 6 QDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEK 65
QDL+++I+RT +FL L +L LEDHLSFESMK NRA NYE VIEINK +NLID +
Sbjct: 231 QDLRAVIRRTAQFLGKDLLDDQVLVLEDHLSFESMKNNRAVNYEPVIEINKTHNLIDAD- 289
Query: 66 CERGAFMRSGKIGG 79
G+FMRSG +GG
Sbjct: 290 ---GSFMRSGTVGG 300
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91090336|ref|XP_966924.1| PREDICTED: similar to sulfotransferase (sult) [Tribolium castaneum] gi|270013819|gb|EFA10267.1| hypothetical protein TcasGA2_TC012467 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|345483186|ref|XP_003424762.1| PREDICTED: sulfotransferase 1C4-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350415215|ref|XP_003490568.1| PREDICTED: sulfotransferase family cytosolic 1B member 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|270015380|gb|EFA11828.1| hypothetical protein TcasGA2_TC005277 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242013096|ref|XP_002427251.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511584|gb|EEB14513.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|340725504|ref|XP_003401109.1| PREDICTED: sulfotransferase 4A1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|357618478|gb|EHJ71439.1| hypothetical protein KGM_19409 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328783624|ref|XP_001122579.2| PREDICTED: sulfotransferase 4A1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|47210634|emb|CAF94448.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| ZFIN|ZDB-GENE-060929-978 | 311 | zgc:153723 "zgc:153723" [Danio | 0.528 | 0.209 | 0.438 | 6.3e-07 | |
| ZFIN|ZDB-GENE-030219-114 | 287 | sult2st1 "sulfotransferase fam | 0.520 | 0.222 | 0.361 | 4e-06 | |
| UNIPROTKB|G3N1S3 | 322 | SULT2B1 "Uncharacterized prote | 0.528 | 0.201 | 0.342 | 0.0001 | |
| UNIPROTKB|I3LRP8 | 315 | SULT2B1 "Uncharacterized prote | 0.544 | 0.212 | 0.346 | 0.00013 | |
| UNIPROTKB|F1P781 | 335 | SULT2B1 "Uncharacterized prote | 0.544 | 0.2 | 0.346 | 0.00014 | |
| UNIPROTKB|E9PKR8 | 192 | SULT1A2 "Sulfotransferase 1A2" | 0.439 | 0.281 | 0.396 | 0.00034 | |
| FB|FBgn0265052 | 331 | St3 "Sulfotransferase 3" [Dros | 0.552 | 0.205 | 0.342 | 0.00038 | |
| ZFIN|ZDB-GENE-061117-4 | 288 | sult2st3 "sulfotransferase fam | 0.528 | 0.225 | 0.328 | 0.00039 | |
| FB|FBgn0034887 | 338 | St1 "Sulfotransferase 1" [Dros | 0.552 | 0.201 | 0.338 | 0.0004 | |
| ZFIN|ZDB-GENE-061117-5 | 287 | sult2st2 "sulfotransferase fam | 0.520 | 0.222 | 0.319 | 0.00049 |
| ZFIN|ZDB-GENE-060929-978 zgc:153723 "zgc:153723" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 120 (47.3 bits), Expect = 6.3e-07, P = 6.3e-07
Identities = 32/73 (43%), Positives = 39/73 (53%)
Query: 6 QDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEK 65
QDL+ +Q+ FL L ++ E H SF SMKEN NY L I KE +ID K
Sbjct: 191 QDLRGSLQKVSHFLQCTLCKEELNLAEKHCSFNSMKENAMVNYTL---IPKE--IIDHSK 245
Query: 66 CERGAFMRSGKIG 78
G FMR GK+G
Sbjct: 246 ---GKFMRKGKVG 255
|
|
| ZFIN|ZDB-GENE-030219-114 sult2st1 "sulfotransferase family 2, cytosolic sulfotransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N1S3 SULT2B1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LRP8 SULT2B1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P781 SULT2B1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PKR8 SULT1A2 "Sulfotransferase 1A2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0265052 St3 "Sulfotransferase 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061117-4 sult2st3 "sulfotransferase family 2, cytosolic sulfotransferase 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034887 St1 "Sulfotransferase 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061117-5 sult2st2 "sulfotransferase family 2, cytosolic sulfotransferase 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| pfam00685 | 254 | pfam00685, Sulfotransfer_1, Sulfotransferase domai | 8e-08 |
| >gnl|CDD|216059 pfam00685, Sulfotransfer_1, Sulfotransferase domain | Back alignment and domain information |
|---|
Score = 48.5 bits (116), Expect = 8e-08
Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 12/74 (16%)
Query: 6 QDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEK 65
+D + I++ +FL PL+ ++ ++ HLSFE+MK N NY + +
Sbjct: 168 KDPRGEIKKIAEFLGIPLTEEELDKIVKHLSFENMKGNPCLNYSKLPKH----------- 216
Query: 66 CERGAFMRSGKIGG 79
E F R G +G
Sbjct: 217 -EVSPFFRKGLVGD 229
|
Length = 254 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| KOG1584|consensus | 297 | 99.91 | ||
| PLN02164 | 346 | sulfotransferase | 99.89 | |
| PF00685 | 267 | Sulfotransfer_1: Sulfotransferase domain; InterPro | 99.46 | |
| KOG1584|consensus | 297 | 98.02 | ||
| PLN02164 | 346 | sulfotransferase | 96.56 | |
| KOG3988|consensus | 378 | 94.76 | ||
| PF09037 | 245 | Sulphotransf: Stf0 sulphotransferase; InterPro: IP | 94.67 | |
| COG4424 | 250 | Uncharacterized protein conserved in bacteria [Fun | 87.17 | |
| PF14069 | 79 | SpoVIF: Stage VI sporulation protein F | 86.73 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 81.07 |
| >KOG1584|consensus | Back alignment and domain information |
|---|
Probab=99.91 E-value=8.4e-26 Score=168.91 Aligned_cols=93 Identities=20% Similarity=0.324 Sum_probs=80.0
Q ss_pred CchhhHhHHHHHHHHHhhcCCCCCHHHHHHHHHhcChHHHhhchhhhhhHHHhhhhcccccccccccccceEEecccCCC
Q psy10123 1 MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGL 80 (123)
Q Consensus 1 ~Edlk~d~~~~v~ria~Flg~~~~~~~l~~iv~~~sfe~Mk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fvRkG~vGdW 80 (123)
||||++||+.+|+|||+|||.++++|++++++.+.+|+.|+.+...|++.. +.+...++ ...|+|||.||||
T Consensus 195 YEdmk~dp~~~ikrlaeFLg~~~~~Ee~~~~~~~~~~~~~~~n~l~nle~n-----~~~~~~~~---~~~F~RKG~vGDW 266 (297)
T KOG1584|consen 195 YEDMKADPKGEIKKLAEFLGCPFTKEEEDKGVVHLSFELCSLNPLSNLEVN-----KTEKLLHK---ISPFFRKGEVGDW 266 (297)
T ss_pred HHHhhhCHHHHHHHHHHHhCCCCCHHHHhhhhHHHHHHHHhhccccCceec-----cccccccc---chhhhcCCCcccc
Confidence 999999999999999999999999999999999999999999988887653 22333333 5789999999999
Q ss_pred ccccccccccccCCCCccchhcCCC
Q psy10123 81 PVYVRDSVGHISNLPGRRFIKAHLP 105 (123)
Q Consensus 81 k~~ft~e~~~~~~~~~pr~i~~hl~ 105 (123)
|||||++|+++|| .+++.++.
T Consensus 267 Kn~~T~~~~ekfD----~~~eekm~ 287 (297)
T KOG1584|consen 267 KNYLTPEMNEKFD----KIYEEKME 287 (297)
T ss_pred cccCCHHHHHHHH----HHHHHHhc
Confidence 9999999999999 55554443
|
|
| >PLN02164 sulfotransferase | Back alignment and domain information |
|---|
| >PF00685 Sulfotransfer_1: Sulfotransferase domain; InterPro: IPR000863 This family includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase | Back alignment and domain information |
|---|
| >KOG1584|consensus | Back alignment and domain information |
|---|
| >PLN02164 sulfotransferase | Back alignment and domain information |
|---|
| >KOG3988|consensus | Back alignment and domain information |
|---|
| >PF09037 Sulphotransf: Stf0 sulphotransferase; InterPro: IPR024628 Members of this family are essential for the biosynthesis of sulpholipid-1 in prokaryotes | Back alignment and domain information |
|---|
| >COG4424 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14069 SpoVIF: Stage VI sporulation protein F | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 123 | ||||
| 1q1z_A | 299 | Crystal Structure Of Human Cholesterol Sulfotransfe | 1e-04 | ||
| 1q1q_A | 350 | Crystal Structure Of Human Pregnenolone Sulfotransf | 1e-04 | ||
| 1z29_A | 295 | Crystal Structures Of Sult1a2 And Sult1a13: Implica | 3e-04 | ||
| 2zpt_X | 295 | Crystal Structure Of Mouse Sulfotransferase Sult1d1 | 8e-04 |
| >pdb|1Q1Z|A Chain A, Crystal Structure Of Human Cholesterol Sulfotransferase (Sult2b1b) In The Presence Of Pap Length = 299 | Back alignment and structure |
|
| >pdb|1Q1Q|A Chain A, Crystal Structure Of Human Pregnenolone Sulfotransferase (Sult2b1a) In The Presence Of Pap Length = 350 | Back alignment and structure |
| >pdb|1Z29|A Chain A, Crystal Structures Of Sult1a2 And Sult1a13: Implications In The Bioactivation Of N-Hydroxy-2-Acetylamino Fluorine (Oh-Aaf) Length = 295 | Back alignment and structure |
| >pdb|2ZPT|X Chain X, Crystal Structure Of Mouse Sulfotransferase Sult1d1 Complex With Pap Length = 295 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| 1fmj_A | 351 | Retinol dehydratase; sulfotransferase, adenosine 3 | 5e-13 | |
| 1j99_A | 293 | Alcohol sulfotransferase; dehydroepiandosterone, D | 1e-11 | |
| 2gwh_A | 298 | Sulfotransferase 1C2; sulfate conjugation, pentach | 7e-11 | |
| 3bfx_A | 296 | Sulfotransferase 1C2; PAP, structural genomics, PS | 8e-11 | |
| 2reo_A | 305 | Putative sulfotransferase 1C3; sulfate conjugation | 2e-10 | |
| 1q44_A | 326 | RARO47, steroid sulfotransferase, AT2G03760/; APO, | 2e-10 | |
| 1q44_A | 326 | RARO47, steroid sulfotransferase, AT2G03760/; APO, | 3e-04 | |
| 1aqu_A | 297 | EST, estrogen sulfotransferase; PAP, sulfonation, | 4e-10 | |
| 1aqu_A | 297 | EST, estrogen sulfotransferase; PAP, sulfonation, | 4e-04 | |
| 2zpt_X | 295 | Tyrosine-ester sulfotransferase; SULT1D1, catechol | 6e-10 | |
| 2zpt_X | 295 | Tyrosine-ester sulfotransferase; SULT1D1, catechol | 4e-04 | |
| 3ckl_A | 298 | Sulfotransferase family cytosolic 1B member 1; SUL | 6e-10 | |
| 3ckl_A | 298 | Sulfotransferase family cytosolic 1B member 1; SUL | 7e-04 | |
| 1ls6_A | 295 | ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno | 7e-10 | |
| 1q20_A | 299 | SULT2B1B, sulfotransferase family, cytosolic, 2B, | 1e-09 | |
| 1q1q_A | 350 | SULT2B1A, sulfotransferase family, cytosolic, 2B, | 3e-09 | |
| 3mgb_A | 319 | TEG12; sulfotransferase, glycopeptide, antibiotic, | 4e-09 | |
| 2ov8_A | 288 | STAL; sulfotransferase, structural genomics, montr | 1e-08 | |
| 1zd1_A | 284 | Sulfotransferase 4A1; SGC, SULT4A1, structural gen | 5e-05 | |
| 1zd1_A | 284 | Sulfotransferase 4A1; SGC, SULT4A1, structural gen | 5e-04 |
| >1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Length = 351 | Back alignment and structure |
|---|
Score = 63.1 bits (153), Expect = 5e-13
Identities = 26/75 (34%), Positives = 32/75 (42%), Gaps = 8/75 (10%)
Query: 5 HQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKE 64
+DL I R FL LS I +L +HL+FE K N A N E EI
Sbjct: 252 LKDLPGCIARIADFLGKKLSEEQIQRLCEHLNFEKFKNNGAVNMEDYREIGILA------ 305
Query: 65 KCERGAFMRSGKIGG 79
+ F+R GK G
Sbjct: 306 --DGEHFIRKGKAGC 318
|
| >1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Length = 293 | Back alignment and structure |
|---|
| >2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Length = 298 | Back alignment and structure |
|---|
| >3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Length = 296 | Back alignment and structure |
|---|
| >2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Length = 305 | Back alignment and structure |
|---|
| >1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Length = 326 | Back alignment and structure |
|---|
| >1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Length = 326 | Back alignment and structure |
|---|
| >1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Length = 297 | Back alignment and structure |
|---|
| >1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Length = 297 | Back alignment and structure |
|---|
| >2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Length = 295 | Back alignment and structure |
|---|
| >2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Length = 295 | Back alignment and structure |
|---|
| >3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Length = 298 | Back alignment and structure |
|---|
| >3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Length = 298 | Back alignment and structure |
|---|
| >1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Length = 295 | Back alignment and structure |
|---|
| >1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Length = 299 | Back alignment and structure |
|---|
| >1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Length = 350 | Back alignment and structure |
|---|
| >3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Length = 319 | Back alignment and structure |
|---|
| >2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* Length = 288 | Back alignment and structure |
|---|
| >1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Length = 284 | Back alignment and structure |
|---|
| >1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Length = 284 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| 3mgb_A | 319 | TEG12; sulfotransferase, glycopeptide, antibiotic, | 99.88 | |
| 1aqu_A | 297 | EST, estrogen sulfotransferase; PAP, sulfonation, | 99.86 | |
| 3ckl_A | 298 | Sulfotransferase family cytosolic 1B member 1; SUL | 99.85 | |
| 1ls6_A | 295 | ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno | 99.85 | |
| 1fmj_A | 351 | Retinol dehydratase; sulfotransferase, adenosine 3 | 99.84 | |
| 2reo_A | 305 | Putative sulfotransferase 1C3; sulfate conjugation | 99.84 | |
| 2gwh_A | 298 | Sulfotransferase 1C2; sulfate conjugation, pentach | 99.84 | |
| 2zpt_X | 295 | Tyrosine-ester sulfotransferase; SULT1D1, catechol | 99.84 | |
| 3bfx_A | 296 | Sulfotransferase 1C2; PAP, structural genomics, PS | 99.84 | |
| 1q20_A | 299 | SULT2B1B, sulfotransferase family, cytosolic, 2B, | 99.84 | |
| 1j99_A | 293 | Alcohol sulfotransferase; dehydroepiandosterone, D | 99.83 | |
| 1q44_A | 326 | RARO47, steroid sulfotransferase, AT2G03760/; APO, | 99.81 | |
| 1q1q_A | 350 | SULT2B1A, sulfotransferase family, cytosolic, 2B, | 99.81 | |
| 2ov8_A | 288 | STAL; sulfotransferase, structural genomics, montr | 99.8 | |
| 1zd1_A | 284 | Sulfotransferase 4A1; SGC, SULT4A1, structural gen | 99.73 | |
| 3ap1_A | 337 | Protein-tyrosine sulfotransferase 2; sulfotransfer | 99.01 | |
| 4gox_A | 313 | Polyketide synthase; olefin synthase, hydrocarbon, | 98.76 | |
| 4gbm_A | 323 | CURM sulfotransferase; polyketide synthase, curaci | 98.42 | |
| 1t8t_A | 271 | Heparan sulfate D-glucosaminyl 3-O- sulfotransfera | 98.0 | |
| 2zq5_A | 384 | Putative uncharacterized protein; sulfotransferase | 97.99 | |
| 2z6v_A | 414 | Putative uncharacterized protein; sulfotransferase | 97.55 | |
| 3bd9_A | 280 | Heparan sulfate glucosamine 3-O-sulfotransferase 5 | 96.89 | |
| 3uan_A | 269 | Heparan sulfate glucosamine 3-O-sulfotransferase; | 96.69 | |
| 3rnl_A | 311 | Sulfotransferase; structural genomics, PSI-biology | 96.37 | |
| 1nst_A | 325 | NST1, heparan sulfate N-deacetylase/N-sulfotransfe | 96.35 | |
| 1tex_A | 287 | STF0 sulfotransferase; sulfolipid, sulfation, TREH | 96.34 | |
| 3mgb_A | 319 | TEG12; sulfotransferase, glycopeptide, antibiotic, | 96.25 | |
| 1fmj_A | 351 | Retinol dehydratase; sulfotransferase, adenosine 3 | 95.71 | |
| 2reo_A | 305 | Putative sulfotransferase 1C3; sulfate conjugation | 94.72 | |
| 1q44_A | 326 | RARO47, steroid sulfotransferase, AT2G03760/; APO, | 93.81 | |
| 1aqu_A | 297 | EST, estrogen sulfotransferase; PAP, sulfonation, | 93.5 | |
| 1q20_A | 299 | SULT2B1B, sulfotransferase family, cytosolic, 2B, | 93.45 | |
| 3bfx_A | 296 | Sulfotransferase 1C2; PAP, structural genomics, PS | 92.71 | |
| 2gwh_A | 298 | Sulfotransferase 1C2; sulfate conjugation, pentach | 92.51 | |
| 2zpt_X | 295 | Tyrosine-ester sulfotransferase; SULT1D1, catechol | 92.27 | |
| 3ckl_A | 298 | Sulfotransferase family cytosolic 1B member 1; SUL | 91.72 | |
| 1q1q_A | 350 | SULT2B1A, sulfotransferase family, cytosolic, 2B, | 91.4 | |
| 1j99_A | 293 | Alcohol sulfotransferase; dehydroepiandosterone, D | 89.8 | |
| 1ls6_A | 295 | ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno | 89.79 | |
| 1zd1_A | 284 | Sulfotransferase 4A1; SGC, SULT4A1, structural gen | 86.54 |
| >3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* | Back alignment and structure |
|---|
Probab=99.88 E-value=2.3e-23 Score=157.48 Aligned_cols=82 Identities=18% Similarity=0.119 Sum_probs=64.9
Q ss_pred CchhhHhHHHHHHHHHhhc--CCCCCHHHHHHHHHhcChHHHhhchhhhhhHHHhhhhcccccccccccccceEEecccC
Q psy10123 1 MLSVHQDLKSIIQRTGKFL--DHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIG 78 (123)
Q Consensus 1 ~Edlk~d~~~~v~ria~Fl--g~~~~~~~l~~iv~~~sfe~Mk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fvRkG~vG 78 (123)
||||++||.++|+|||+|| |++++++.+++|+++|||++||+++..+.... +...++. ...|+|||+||
T Consensus 201 YEDL~~Dp~~~v~kI~~FL~~G~~~~~e~l~~iv~~~SFe~MK~~~~~~~~~~-----~~~~~~~----~~~f~RKG~vG 271 (319)
T 3mgb_A 201 YEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEQQG-----GGSPIRH----GDARMMKGGPG 271 (319)
T ss_dssp HHHHHHCHHHHHHHHHHHHTCSSCCCHHHHHHHHHTTSHHHHHHHHHHC---------CCCCC----------CCSCSGG
T ss_pred HHHHHHhHHHHHHHHHHHHhcCCCCCHHHHHHHHHHCCHHHHHhhHhhccccC-----CcccccC----CCcceeCCCcC
Confidence 8999999999999999999 99999999999999999999999877664431 2222222 34899999999
Q ss_pred CCccccccccccc
Q psy10123 79 GLPVYVRDSVGHI 91 (123)
Q Consensus 79 dWk~~ft~e~~~~ 91 (123)
|||||||+|+...
T Consensus 272 dWkn~ft~e~~~~ 284 (319)
T 3mgb_A 272 GARPQFVGEGRYD 284 (319)
T ss_dssp GCCCCSSCCCCSS
T ss_pred cccccCChhhccc
Confidence 9999999988743
|
| >1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* | Back alignment and structure |
|---|
| >3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* | Back alignment and structure |
|---|
| >1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* | Back alignment and structure |
|---|
| >1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* | Back alignment and structure |
|---|
| >2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* | Back alignment and structure |
|---|
| >2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* | Back alignment and structure |
|---|
| >2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* | Back alignment and structure |
|---|
| >3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 | Back alignment and structure |
|---|
| >1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* | Back alignment and structure |
|---|
| >1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* | Back alignment and structure |
|---|
| >1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A | Back alignment and structure |
|---|
| >1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 | Back alignment and structure |
|---|
| >2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* | Back alignment and structure |
|---|
| >1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3ap1_A Protein-tyrosine sulfotransferase 2; sulfotransferase fold, transferase; HET: A3P; 1.90A {Homo sapiens} PDB: 3ap2_A* 3ap3_A* | Back alignment and structure |
|---|
| >4gox_A Polyketide synthase; olefin synthase, hydrocarbon, sulfotran PAPS, PAP, 3'phosphoadenosine-5'phosphosulfate, transferase; HET: A3P; 2.15A {Synechococcus SP} | Back alignment and structure |
|---|
| >4gbm_A CURM sulfotransferase; polyketide synthase, curacin, PAP, PAPS; HET: A3P P6G; 1.62A {Moorea producta} | Back alignment and structure |
|---|
| >1t8t_A Heparan sulfate D-glucosaminyl 3-O- sulfotransferase 3A1; alpha-beta motif, substrate-binding cleft; HET: A3P CIT; 1.85A {Homo sapiens} SCOP: c.37.1.5 PDB: 1t8u_A* | Back alignment and structure |
|---|
| >2zq5_A Putative uncharacterized protein; sulfotransferase fold; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2z6v_A Putative uncharacterized protein; sulfotransferase, unknown function; HET: PLM; 2.60A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3bd9_A Heparan sulfate glucosamine 3-O-sulfotransferase 5; heparan sulfate biosynthesis, substrate specificity, glycoprotein, golgi apparatus, membrane; HET: A3P; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3uan_A Heparan sulfate glucosamine 3-O-sulfotransferase; alpha/beta motif, CO-FACT PAPS/PAP, heparan sulfate oligosaccharides, golgi-localized transferase; HET: A3P NGY BDP SGN IDS; 1.84A {Mus musculus} PDB: 1vkj_A* 1zrh_A* | Back alignment and structure |
|---|
| >3rnl_A Sulfotransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.75A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1nst_A NST1, heparan sulfate N-deacetylase/N-sulfotransferase; PAP, haparin sulfate, haparin sulfate biosynthesis, glycoprotein; HET: A3P; 2.30A {Homo sapiens} SCOP: c.37.1.5 | Back alignment and structure |
|---|
| >1tex_A STF0 sulfotransferase; sulfolipid, sulfation, TREH trehalose-2-sulfate; HET: TRE; 2.60A {Mycobacterium smegmatis} SCOP: c.37.1.5 | Back alignment and structure |
|---|
| >3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* | Back alignment and structure |
|---|
| >1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* | Back alignment and structure |
|---|
| >2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* | Back alignment and structure |
|---|
| >1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A | Back alignment and structure |
|---|
| >1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* | Back alignment and structure |
|---|
| >1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* | Back alignment and structure |
|---|
| >3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 | Back alignment and structure |
|---|
| >2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* | Back alignment and structure |
|---|
| >2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* | Back alignment and structure |
|---|
| >3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* | Back alignment and structure |
|---|
| >1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 | Back alignment and structure |
|---|
| >1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* | Back alignment and structure |
|---|
| >1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* | Back alignment and structure |
|---|
| >1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 123 | ||||
| d1ls6a_ | 288 | c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human | 1e-06 | |
| d1j99a_ | 284 | c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult | 5e-06 | |
| d3bfxa1 | 285 | c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Huma | 1e-05 | |
| d2z5fa_ | 293 | c.37.1.5 (A:) Thyroid hormone sulfotransferase Sul | 2e-05 | |
| d1q20a_ | 294 | c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1 | 3e-05 | |
| d1g3ma_ | 290 | c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult | 7e-05 | |
| d1fmja_ | 342 | c.37.1.5 (A:) Retinol dehydratase {Fall armyworm ( | 1e-04 | |
| d1q44a_ | 320 | c.37.1.5 (A:) Putative steroid sulfotransferase ra | 2e-04 |
| >d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: PAPS sulfotransferase domain: Aryl sulfotransferase sult1a species: Human (Homo sapiens) [TaxId: 9606]
Score = 43.6 bits (102), Expect = 1e-06
Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 8/76 (10%)
Query: 4 VHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDK 63
+ ++ K IQ+ +F+ H L + + H SF+ MK+N TNY V + +++
Sbjct: 189 MKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHS---- 244
Query: 64 EKCERGAFMRSGKIGG 79
FMR G G
Sbjct: 245 ----ISPFMRKGMAGD 256
|
| >d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]} Length = 290 | Back information, alignment and structure |
|---|
| >d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Length = 342 | Back information, alignment and structure |
|---|
| >d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| d3bfxa1 | 285 | Sulfotransferase Sult1c2 {Human (Homo sapiens) [Ta | 99.88 | |
| d1fmja_ | 342 | Retinol dehydratase {Fall armyworm (Spodoptera fru | 99.87 | |
| d1ls6a_ | 288 | Aryl sulfotransferase sult1a {Human (Homo sapiens) | 99.87 | |
| d2z5fa_ | 293 | Thyroid hormone sulfotransferase Sult1b1 {Human (H | 99.87 | |
| d1q44a_ | 320 | Putative steroid sulfotransferase rarO47 {Thale cr | 99.86 | |
| d1q20a_ | 294 | Cholesterol sulfotransferase sult2b1b {Human (Homo | 99.85 | |
| d1j99a_ | 284 | Hydroxysteroid sulfotransferase sult2a1 {Human (Ho | 99.84 | |
| d1g3ma_ | 290 | Estrogen sulfotransferase (STE, sult1e1) {Human (H | 99.84 | |
| d1texa_ | 265 | Stf0 sulfotransferase {Mycobacterium smegmatis [Ta | 96.91 | |
| d1t8ta_ | 271 | Heparan sulfate glucosamine 3-O-sulfotransferase 3 | 96.48 | |
| d1vkja_ | 258 | Heparan sulfate 3-O-sulfotransferase {Mouse (Mus m | 96.24 | |
| d1nsta_ | 301 | Heparan sulfate N-deacetylase/N-sulfotransferase d | 96.14 | |
| d1q44a_ | 320 | Putative steroid sulfotransferase rarO47 {Thale cr | 87.81 | |
| d1jjcb2 | 75 | Domains B1 and B5 of PheRS-beta, PheT {Thermus the | 80.48 |
| >d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: PAPS sulfotransferase domain: Sulfotransferase Sult1c2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=2e-24 Score=159.04 Aligned_cols=93 Identities=22% Similarity=0.337 Sum_probs=69.5
Q ss_pred CchhhHhHHHHHHHHHhhcCCCCCHHHHHHHHHhcChHHHhhchhhhhhHHHhhhhcccccccccccccceEEecccCCC
Q psy10123 1 MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGL 80 (123)
Q Consensus 1 ~Edlk~d~~~~v~ria~Flg~~~~~~~l~~iv~~~sfe~Mk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fvRkG~vGdW 80 (123)
||||++|+.++|++||+|||++++++.++.|+++|||++||++...+...+.. ...+.+ ...|||+|.+|+|
T Consensus 183 YEdL~~d~~~~v~kI~~FLg~~~~~~~i~~i~~~~sF~~mk~~e~~~~~~~~~-----~~~~~~---~~~FfRkG~~G~W 254 (285)
T d3bfxa1 183 YEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSK-----SILDQS---ISSFMRKGTVGDW 254 (285)
T ss_dssp HHHHHHCHHHHHHHHHHHTTCCCCHHHHHHHHHHTSHHHHHHC---------------------------CCCCCCSCTH
T ss_pred HhHHhhhHHHHHHHHHHhhcccccHHHHHHHHHHcCHHHHHhhHHhccccccc-----ccccCC---CCCeeeCCCCCCc
Confidence 89999999999999999999999999999999999999999987665443211 112222 5689999999999
Q ss_pred ccccccccccccCCCCccchhcCCC
Q psy10123 81 PVYVRDSVGHISNLPGRRFIKAHLP 105 (123)
Q Consensus 81 k~~ft~e~~~~~~~~~pr~i~~hl~ 105 (123)
|++||++|.++|+ ++++.+|.
T Consensus 255 k~~~s~eq~~~~~----~~~~e~m~ 275 (285)
T d3bfxa1 255 KNHFTVAQNERFD----EIYRRKME 275 (285)
T ss_dssp HHHCCHHHHHHHH----HHHHHHHT
T ss_pred hhhCCHHHHHHHH----HHHHHHhC
Confidence 9999999999999 55555443
|
| >d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} | Back information, alignment and structure |
|---|
| >d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1texa_ c.37.1.5 (A:) Stf0 sulfotransferase {Mycobacterium smegmatis [TaxId: 1772]} | Back information, alignment and structure |
|---|
| >d1t8ta_ c.37.1.5 (A:) Heparan sulfate glucosamine 3-O-sulfotransferase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vkja_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jjcb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|