Psyllid ID: psy10123


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKLQDGSTKAKGR
ccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHccccccccccccccEEccccccccccccHHHHHHHHHHHccccccccccccccccHHccccccccc
cccccccHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHcccccHHHHHHHHHccccccccccccccEEEccccccccHccccccccccccccccccccccccccccHHHcccccccccc
MLSVHQDLKSIIQRTgkfldhplstpdilqledhlsfesmkeNRATNYELVIEINkennlidkekcergafmrsgkigglpvyvrdsvghisnlpgrrfikahlplrllpkklqdgstkakgr
MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIeinkennlidkekcerGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIkahlplrllpkklqdgstkakgr
MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKLQDGSTKAKGR
***********IQRTGKFLDHPLSTPDILQLEDHLSF*****NRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLL**************
*LSVH*DLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKLQ*********
MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKL**********
**SVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKK*Q*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGLPVYVRDSVGHISNLPGRRFIKAHLPLRLLPKKLQDGSTKAKGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
193580236 328 PREDICTED: amine sulfotransferase-like [ 0.569 0.213 0.608 3e-16
91090336 321 PREDICTED: similar to sulfotransferase ( 0.569 0.218 0.486 1e-10
345483186 327 PREDICTED: sulfotransferase 1C4-like [Na 0.634 0.238 0.463 4e-10
350415215 324 PREDICTED: sulfotransferase family cytos 0.764 0.290 0.404 3e-08
270015380 318 hypothetical protein TcasGA2_TC005277 [T 0.593 0.229 0.441 5e-08
242013096 328 conserved hypothetical protein [Pediculu 0.560 0.210 0.452 7e-08
340725504 324 PREDICTED: sulfotransferase 4A1-like [Bo 0.780 0.296 0.376 4e-07
357618478 309 hypothetical protein KGM_19409 [Danaus p 0.658 0.262 0.333 1e-06
328783624 328 PREDICTED: sulfotransferase 4A1-like [Ap 0.544 0.204 0.450 1e-06
47210634 252 unnamed protein product [Tetraodon nigro 0.520 0.253 0.402 1e-05
>gi|193580236|ref|XP_001949676.1| PREDICTED: amine sulfotransferase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 55/74 (74%), Gaps = 4/74 (5%)

Query: 6   QDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEK 65
           QDL+++I+RT +FL   L    +L LEDHLSFESMK NRA NYE VIEINK +NLID + 
Sbjct: 231 QDLRAVIRRTAQFLGKDLLDDQVLVLEDHLSFESMKNNRAVNYEPVIEINKTHNLIDAD- 289

Query: 66  CERGAFMRSGKIGG 79
              G+FMRSG +GG
Sbjct: 290 ---GSFMRSGTVGG 300




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91090336|ref|XP_966924.1| PREDICTED: similar to sulfotransferase (sult) [Tribolium castaneum] gi|270013819|gb|EFA10267.1| hypothetical protein TcasGA2_TC012467 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345483186|ref|XP_003424762.1| PREDICTED: sulfotransferase 1C4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350415215|ref|XP_003490568.1| PREDICTED: sulfotransferase family cytosolic 1B member 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|270015380|gb|EFA11828.1| hypothetical protein TcasGA2_TC005277 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242013096|ref|XP_002427251.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511584|gb|EEB14513.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340725504|ref|XP_003401109.1| PREDICTED: sulfotransferase 4A1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|357618478|gb|EHJ71439.1| hypothetical protein KGM_19409 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328783624|ref|XP_001122579.2| PREDICTED: sulfotransferase 4A1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|47210634|emb|CAF94448.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
ZFIN|ZDB-GENE-060929-978311 zgc:153723 "zgc:153723" [Danio 0.528 0.209 0.438 6.3e-07
ZFIN|ZDB-GENE-030219-114287 sult2st1 "sulfotransferase fam 0.520 0.222 0.361 4e-06
UNIPROTKB|G3N1S3322 SULT2B1 "Uncharacterized prote 0.528 0.201 0.342 0.0001
UNIPROTKB|I3LRP8315 SULT2B1 "Uncharacterized prote 0.544 0.212 0.346 0.00013
UNIPROTKB|F1P781335 SULT2B1 "Uncharacterized prote 0.544 0.2 0.346 0.00014
UNIPROTKB|E9PKR8192 SULT1A2 "Sulfotransferase 1A2" 0.439 0.281 0.396 0.00034
FB|FBgn0265052331 St3 "Sulfotransferase 3" [Dros 0.552 0.205 0.342 0.00038
ZFIN|ZDB-GENE-061117-4288 sult2st3 "sulfotransferase fam 0.528 0.225 0.328 0.00039
FB|FBgn0034887338 St1 "Sulfotransferase 1" [Dros 0.552 0.201 0.338 0.0004
ZFIN|ZDB-GENE-061117-5287 sult2st2 "sulfotransferase fam 0.520 0.222 0.319 0.00049
ZFIN|ZDB-GENE-060929-978 zgc:153723 "zgc:153723" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 120 (47.3 bits), Expect = 6.3e-07, P = 6.3e-07
 Identities = 32/73 (43%), Positives = 39/73 (53%)

Query:     6 QDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEK 65
             QDL+  +Q+   FL   L   ++   E H SF SMKEN   NY L   I KE  +ID  K
Sbjct:   191 QDLRGSLQKVSHFLQCTLCKEELNLAEKHCSFNSMKENAMVNYTL---IPKE--IIDHSK 245

Query:    66 CERGAFMRSGKIG 78
                G FMR GK+G
Sbjct:   246 ---GKFMRKGKVG 255




GO:0008146 "sulfotransferase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
ZFIN|ZDB-GENE-030219-114 sult2st1 "sulfotransferase family 2, cytosolic sulfotransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3N1S3 SULT2B1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRP8 SULT2B1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P781 SULT2B1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PKR8 SULT1A2 "Sulfotransferase 1A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0265052 St3 "Sulfotransferase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061117-4 sult2st3 "sulfotransferase family 2, cytosolic sulfotransferase 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0034887 St1 "Sulfotransferase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061117-5 sult2st2 "sulfotransferase family 2, cytosolic sulfotransferase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
pfam00685254 pfam00685, Sulfotransfer_1, Sulfotransferase domai 8e-08
>gnl|CDD|216059 pfam00685, Sulfotransfer_1, Sulfotransferase domain Back     alignment and domain information
 Score = 48.5 bits (116), Expect = 8e-08
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 12/74 (16%)

Query: 6   QDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEK 65
           +D +  I++  +FL  PL+  ++ ++  HLSFE+MK N   NY  + +            
Sbjct: 168 KDPRGEIKKIAEFLGIPLTEEELDKIVKHLSFENMKGNPCLNYSKLPKH----------- 216

Query: 66  CERGAFMRSGKIGG 79
            E   F R G +G 
Sbjct: 217 -EVSPFFRKGLVGD 229


Length = 254

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
KOG1584|consensus297 99.91
PLN02164346 sulfotransferase 99.89
PF00685267 Sulfotransfer_1: Sulfotransferase domain; InterPro 99.46
KOG1584|consensus 297 98.02
PLN02164 346 sulfotransferase 96.56
KOG3988|consensus378 94.76
PF09037245 Sulphotransf: Stf0 sulphotransferase; InterPro: IP 94.67
COG4424250 Uncharacterized protein conserved in bacteria [Fun 87.17
PF1406979 SpoVIF: Stage VI sporulation protein F 86.73
PF0296966 TAF: TATA box binding protein associated factor (T 81.07
>KOG1584|consensus Back     alignment and domain information
Probab=99.91  E-value=8.4e-26  Score=168.91  Aligned_cols=93  Identities=20%  Similarity=0.324  Sum_probs=80.0

Q ss_pred             CchhhHhHHHHHHHHHhhcCCCCCHHHHHHHHHhcChHHHhhchhhhhhHHHhhhhcccccccccccccceEEecccCCC
Q psy10123          1 MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGL   80 (123)
Q Consensus         1 ~Edlk~d~~~~v~ria~Flg~~~~~~~l~~iv~~~sfe~Mk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fvRkG~vGdW   80 (123)
                      ||||++||+.+|+|||+|||.++++|++++++.+.+|+.|+.+...|++..     +.+...++   ...|+|||.||||
T Consensus       195 YEdmk~dp~~~ikrlaeFLg~~~~~Ee~~~~~~~~~~~~~~~n~l~nle~n-----~~~~~~~~---~~~F~RKG~vGDW  266 (297)
T KOG1584|consen  195 YEDMKADPKGEIKKLAEFLGCPFTKEEEDKGVVHLSFELCSLNPLSNLEVN-----KTEKLLHK---ISPFFRKGEVGDW  266 (297)
T ss_pred             HHHhhhCHHHHHHHHHHHhCCCCCHHHHhhhhHHHHHHHHhhccccCceec-----cccccccc---chhhhcCCCcccc
Confidence            999999999999999999999999999999999999999999988887653     22333333   5789999999999


Q ss_pred             ccccccccccccCCCCccchhcCCC
Q psy10123         81 PVYVRDSVGHISNLPGRRFIKAHLP  105 (123)
Q Consensus        81 k~~ft~e~~~~~~~~~pr~i~~hl~  105 (123)
                      |||||++|+++||    .+++.++.
T Consensus       267 Kn~~T~~~~ekfD----~~~eekm~  287 (297)
T KOG1584|consen  267 KNYLTPEMNEKFD----KIYEEKME  287 (297)
T ss_pred             cccCCHHHHHHHH----HHHHHHhc
Confidence            9999999999999    55554443



>PLN02164 sulfotransferase Back     alignment and domain information
>PF00685 Sulfotransfer_1: Sulfotransferase domain; InterPro: IPR000863 This family includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase Back     alignment and domain information
>KOG1584|consensus Back     alignment and domain information
>PLN02164 sulfotransferase Back     alignment and domain information
>KOG3988|consensus Back     alignment and domain information
>PF09037 Sulphotransf: Stf0 sulphotransferase; InterPro: IPR024628 Members of this family are essential for the biosynthesis of sulpholipid-1 in prokaryotes Back     alignment and domain information
>COG4424 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14069 SpoVIF: Stage VI sporulation protein F Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1q1z_A299 Crystal Structure Of Human Cholesterol Sulfotransfe 1e-04
1q1q_A350 Crystal Structure Of Human Pregnenolone Sulfotransf 1e-04
1z29_A 295 Crystal Structures Of Sult1a2 And Sult1a13: Implica 3e-04
2zpt_X 295 Crystal Structure Of Mouse Sulfotransferase Sult1d1 8e-04
>pdb|1Q1Z|A Chain A, Crystal Structure Of Human Cholesterol Sulfotransferase (Sult2b1b) In The Presence Of Pap Length = 299 Back     alignment and structure

Iteration: 1

Score = 41.6 bits (96), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 8/75 (10%) Query: 4 VHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDK 63 + QDL+ ++R FL PL + + H +F +MK N +NY L+ +L+D Sbjct: 200 LQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLL-----PPSLLDH 254 Query: 64 EKCERGAFMRSGKIG 78 RGAF+R G G Sbjct: 255 ---RRGAFLRKGVCG 266
>pdb|1Q1Q|A Chain A, Crystal Structure Of Human Pregnenolone Sulfotransferase (Sult2b1a) In The Presence Of Pap Length = 350 Back     alignment and structure
>pdb|1Z29|A Chain A, Crystal Structures Of Sult1a2 And Sult1a13: Implications In The Bioactivation Of N-Hydroxy-2-Acetylamino Fluorine (Oh-Aaf) Length = 295 Back     alignment and structure
>pdb|2ZPT|X Chain X, Crystal Structure Of Mouse Sulfotransferase Sult1d1 Complex With Pap Length = 295 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1fmj_A351 Retinol dehydratase; sulfotransferase, adenosine 3 5e-13
1j99_A293 Alcohol sulfotransferase; dehydroepiandosterone, D 1e-11
2gwh_A298 Sulfotransferase 1C2; sulfate conjugation, pentach 7e-11
3bfx_A296 Sulfotransferase 1C2; PAP, structural genomics, PS 8e-11
2reo_A305 Putative sulfotransferase 1C3; sulfate conjugation 2e-10
1q44_A326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 2e-10
1q44_A 326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 3e-04
1aqu_A297 EST, estrogen sulfotransferase; PAP, sulfonation, 4e-10
1aqu_A 297 EST, estrogen sulfotransferase; PAP, sulfonation, 4e-04
2zpt_X295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 6e-10
2zpt_X 295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 4e-04
3ckl_A298 Sulfotransferase family cytosolic 1B member 1; SUL 6e-10
3ckl_A 298 Sulfotransferase family cytosolic 1B member 1; SUL 7e-04
1ls6_A295 ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno 7e-10
1q20_A299 SULT2B1B, sulfotransferase family, cytosolic, 2B, 1e-09
1q1q_A350 SULT2B1A, sulfotransferase family, cytosolic, 2B, 3e-09
3mgb_A319 TEG12; sulfotransferase, glycopeptide, antibiotic, 4e-09
2ov8_A288 STAL; sulfotransferase, structural genomics, montr 1e-08
1zd1_A284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 5e-05
1zd1_A 284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 5e-04
>1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Length = 351 Back     alignment and structure
 Score = 63.1 bits (153), Expect = 5e-13
 Identities = 26/75 (34%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 5   HQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKE 64
            +DL   I R   FL   LS   I +L +HL+FE  K N A N E   EI          
Sbjct: 252 LKDLPGCIARIADFLGKKLSEEQIQRLCEHLNFEKFKNNGAVNMEDYREIGILA------ 305

Query: 65  KCERGAFMRSGKIGG 79
             +   F+R GK G 
Sbjct: 306 --DGEHFIRKGKAGC 318


>1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Length = 293 Back     alignment and structure
>2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Length = 298 Back     alignment and structure
>3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Length = 296 Back     alignment and structure
>2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Length = 305 Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Length = 326 Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Length = 326 Back     alignment and structure
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Length = 297 Back     alignment and structure
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Length = 297 Back     alignment and structure
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Length = 295 Back     alignment and structure
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Length = 295 Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Length = 298 Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Length = 298 Back     alignment and structure
>1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Length = 295 Back     alignment and structure
>1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Length = 299 Back     alignment and structure
>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Length = 350 Back     alignment and structure
>3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Length = 319 Back     alignment and structure
>2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* Length = 288 Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Length = 284 Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Length = 284 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
3mgb_A319 TEG12; sulfotransferase, glycopeptide, antibiotic, 99.88
1aqu_A297 EST, estrogen sulfotransferase; PAP, sulfonation, 99.86
3ckl_A298 Sulfotransferase family cytosolic 1B member 1; SUL 99.85
1ls6_A295 ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno 99.85
1fmj_A351 Retinol dehydratase; sulfotransferase, adenosine 3 99.84
2reo_A305 Putative sulfotransferase 1C3; sulfate conjugation 99.84
2gwh_A298 Sulfotransferase 1C2; sulfate conjugation, pentach 99.84
2zpt_X295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 99.84
3bfx_A296 Sulfotransferase 1C2; PAP, structural genomics, PS 99.84
1q20_A299 SULT2B1B, sulfotransferase family, cytosolic, 2B, 99.84
1j99_A293 Alcohol sulfotransferase; dehydroepiandosterone, D 99.83
1q44_A326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 99.81
1q1q_A350 SULT2B1A, sulfotransferase family, cytosolic, 2B, 99.81
2ov8_A288 STAL; sulfotransferase, structural genomics, montr 99.8
1zd1_A284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 99.73
3ap1_A337 Protein-tyrosine sulfotransferase 2; sulfotransfer 99.01
4gox_A313 Polyketide synthase; olefin synthase, hydrocarbon, 98.76
4gbm_A323 CURM sulfotransferase; polyketide synthase, curaci 98.42
1t8t_A271 Heparan sulfate D-glucosaminyl 3-O- sulfotransfera 98.0
2zq5_A384 Putative uncharacterized protein; sulfotransferase 97.99
2z6v_A414 Putative uncharacterized protein; sulfotransferase 97.55
3bd9_A280 Heparan sulfate glucosamine 3-O-sulfotransferase 5 96.89
3uan_A269 Heparan sulfate glucosamine 3-O-sulfotransferase; 96.69
3rnl_A311 Sulfotransferase; structural genomics, PSI-biology 96.37
1nst_A325 NST1, heparan sulfate N-deacetylase/N-sulfotransfe 96.35
1tex_A287 STF0 sulfotransferase; sulfolipid, sulfation, TREH 96.34
3mgb_A 319 TEG12; sulfotransferase, glycopeptide, antibiotic, 96.25
1fmj_A 351 Retinol dehydratase; sulfotransferase, adenosine 3 95.71
2reo_A 305 Putative sulfotransferase 1C3; sulfate conjugation 94.72
1q44_A 326 RARO47, steroid sulfotransferase, AT2G03760/; APO, 93.81
1aqu_A 297 EST, estrogen sulfotransferase; PAP, sulfonation, 93.5
1q20_A 299 SULT2B1B, sulfotransferase family, cytosolic, 2B, 93.45
3bfx_A 296 Sulfotransferase 1C2; PAP, structural genomics, PS 92.71
2gwh_A 298 Sulfotransferase 1C2; sulfate conjugation, pentach 92.51
2zpt_X 295 Tyrosine-ester sulfotransferase; SULT1D1, catechol 92.27
3ckl_A 298 Sulfotransferase family cytosolic 1B member 1; SUL 91.72
1q1q_A 350 SULT2B1A, sulfotransferase family, cytosolic, 2B, 91.4
1j99_A 293 Alcohol sulfotransferase; dehydroepiandosterone, D 89.8
1ls6_A 295 ARYL sulfotransferase; SULT 1A1, PAP, P-nitropheno 89.79
1zd1_A 284 Sulfotransferase 4A1; SGC, SULT4A1, structural gen 86.54
>3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Back     alignment and structure
Probab=99.88  E-value=2.3e-23  Score=157.48  Aligned_cols=82  Identities=18%  Similarity=0.119  Sum_probs=64.9

Q ss_pred             CchhhHhHHHHHHHHHhhc--CCCCCHHHHHHHHHhcChHHHhhchhhhhhHHHhhhhcccccccccccccceEEecccC
Q psy10123          1 MLSVHQDLKSIIQRTGKFL--DHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIG   78 (123)
Q Consensus         1 ~Edlk~d~~~~v~ria~Fl--g~~~~~~~l~~iv~~~sfe~Mk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fvRkG~vG   78 (123)
                      ||||++||.++|+|||+||  |++++++.+++|+++|||++||+++..+....     +...++.    ...|+|||+||
T Consensus       201 YEDL~~Dp~~~v~kI~~FL~~G~~~~~e~l~~iv~~~SFe~MK~~~~~~~~~~-----~~~~~~~----~~~f~RKG~vG  271 (319)
T 3mgb_A          201 YEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAVAASTLERMRELEKRSEQQG-----GGSPIRH----GDARMMKGGPG  271 (319)
T ss_dssp             HHHHHHCHHHHHHHHHHHHTCSSCCCHHHHHHHHHTTSHHHHHHHHHHC---------CCCCC----------CCSCSGG
T ss_pred             HHHHHHhHHHHHHHHHHHHhcCCCCCHHHHHHHHHHCCHHHHHhhHhhccccC-----CcccccC----CCcceeCCCcC
Confidence            8999999999999999999  99999999999999999999999877664431     2222222    34899999999


Q ss_pred             CCccccccccccc
Q psy10123         79 GLPVYVRDSVGHI   91 (123)
Q Consensus        79 dWk~~ft~e~~~~   91 (123)
                      |||||||+|+...
T Consensus       272 dWkn~ft~e~~~~  284 (319)
T 3mgb_A          272 GARPQFVGEGRYD  284 (319)
T ss_dssp             GCCCCSSCCCCSS
T ss_pred             cccccCChhhccc
Confidence            9999999988743



>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Back     alignment and structure
>1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Back     alignment and structure
>1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Back     alignment and structure
>2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Back     alignment and structure
>2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Back     alignment and structure
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Back     alignment and structure
>3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Back     alignment and structure
>1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Back     alignment and structure
>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>2ov8_A STAL; sulfotransferase, structural genomics, montr kingston bacterial structural genomics initiative, BSGI, UN function; 2.58A {Streptomyces toyocaensis} PDB: 2ovb_A 2ovf_A* Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Back     alignment and structure
>3ap1_A Protein-tyrosine sulfotransferase 2; sulfotransferase fold, transferase; HET: A3P; 1.90A {Homo sapiens} PDB: 3ap2_A* 3ap3_A* Back     alignment and structure
>4gox_A Polyketide synthase; olefin synthase, hydrocarbon, sulfotran PAPS, PAP, 3'phosphoadenosine-5'phosphosulfate, transferase; HET: A3P; 2.15A {Synechococcus SP} Back     alignment and structure
>4gbm_A CURM sulfotransferase; polyketide synthase, curacin, PAP, PAPS; HET: A3P P6G; 1.62A {Moorea producta} Back     alignment and structure
>1t8t_A Heparan sulfate D-glucosaminyl 3-O- sulfotransferase 3A1; alpha-beta motif, substrate-binding cleft; HET: A3P CIT; 1.85A {Homo sapiens} SCOP: c.37.1.5 PDB: 1t8u_A* Back     alignment and structure
>2zq5_A Putative uncharacterized protein; sulfotransferase fold; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2z6v_A Putative uncharacterized protein; sulfotransferase, unknown function; HET: PLM; 2.60A {Mycobacterium avium} Back     alignment and structure
>3bd9_A Heparan sulfate glucosamine 3-O-sulfotransferase 5; heparan sulfate biosynthesis, substrate specificity, glycoprotein, golgi apparatus, membrane; HET: A3P; 2.30A {Homo sapiens} Back     alignment and structure
>3uan_A Heparan sulfate glucosamine 3-O-sulfotransferase; alpha/beta motif, CO-FACT PAPS/PAP, heparan sulfate oligosaccharides, golgi-localized transferase; HET: A3P NGY BDP SGN IDS; 1.84A {Mus musculus} PDB: 1vkj_A* 1zrh_A* Back     alignment and structure
>3rnl_A Sulfotransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.75A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1nst_A NST1, heparan sulfate N-deacetylase/N-sulfotransferase; PAP, haparin sulfate, haparin sulfate biosynthesis, glycoprotein; HET: A3P; 2.30A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>1tex_A STF0 sulfotransferase; sulfolipid, sulfation, TREH trehalose-2-sulfate; HET: TRE; 2.60A {Mycobacterium smegmatis} SCOP: c.37.1.5 Back     alignment and structure
>3mgb_A TEG12; sulfotransferase, glycopeptide, antibiotic, transferase-anti complex; HET: GHP 3MY 3FG OMY PAP; 2.04A {Uncultured soil bacterium} PDB: 3mgc_A* 3mg9_A* 3nib_A* Back     alignment and structure
>1fmj_A Retinol dehydratase; sulfotransferase, adenosine 3',5'- diphosphate; HET: A3P RTL; 2.00A {Spodoptera frugiperda} SCOP: c.37.1.5 PDB: 1fml_A* 1x8l_A* 1x8k_A* 1x8j_A* Back     alignment and structure
>2reo_A Putative sulfotransferase 1C3; sulfate conjugation, PAP, structural genom consortium, SGC; HET: A3P; 2.65A {Homo sapiens} PDB: 2h8k_A* Back     alignment and structure
>1q44_A RARO47, steroid sulfotransferase, AT2G03760/; APO, structu genomics, protein structure initiative, center for eukaryot structural genomics; 1.90A {Arabidopsis thaliana} SCOP: c.37.1.5 PDB: 2q3m_A Back     alignment and structure
>1aqu_A EST, estrogen sulfotransferase; PAP, sulfonation, 17-beta estradiol, steroid-binding; HET: A3P EST; 1.60A {Mus musculus} SCOP: c.37.1.5 PDB: 1aqy_A* 1bo6_A* 1hy3_A* 1g3m_A* Back     alignment and structure
>1q20_A SULT2B1B, sulfotransferase family, cytosolic, 2B, member 1 isoform B; pregnenolone, cholesterol, PAP; HET: A3P PLO; 2.30A {Homo sapiens} SCOP: c.37.1.5 PDB: 1q1z_A* 1q22_A* Back     alignment and structure
>3bfx_A Sulfotransferase 1C2; PAP, structural genomics, PSI, protein structure initiative, structural genomics consortium, SGC, alternative splicing; HET: A3P; 1.80A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>2gwh_A Sulfotransferase 1C2; sulfate conjugation, pentachlorophenol, PA pesticide, structural genomics, structural genomics consort transferase; HET: A3P PCI; 1.80A {Homo sapiens} PDB: 2ad1_A* Back     alignment and structure
>2zpt_X Tyrosine-ester sulfotransferase; SULT1D1, catecholamine, sulfonation; HET: A3P GOL; 1.15A {Mus musculus} PDB: 2zvp_X* 2zvq_X* 2zyt_X* 2zyu_X* 2zyv_X* 2zyw_X* Back     alignment and structure
>3ckl_A Sulfotransferase family cytosolic 1B member 1; SULT1B1, human cytosolic sulfotransferase, resveratrol, SGC, cytoplasm, lipid metabolism; HET: STL A3P; 2.00A {Homo sapiens} PDB: 2z5f_A* Back     alignment and structure
>1q1q_A SULT2B1A, sulfotransferase family, cytosolic, 2B, member 1 isoform A; pregnenolone, PAP; HET: A3P NHE; 2.91A {Homo sapiens} SCOP: c.37.1.5 Back     alignment and structure
>1j99_A Alcohol sulfotransferase; dehydroepiandosterone, DHEA; HET: AND; 1.99A {Homo sapiens} SCOP: c.37.1.5 PDB: 1ov4_A* 3f3y_A* 2qp3_A* 2qp4_A* 1efh_A* Back     alignment and structure
>1ls6_A ARYL sulfotransferase; SULT 1A1, PAP, P-nitrophenol, positive cooperativity, two substrate binding sites; HET: A3P NPO; 1.90A {Homo sapiens} SCOP: c.37.1.5 PDB: 2d06_A* 3u3o_A* 3u3k_A* 3u3m_A* 3u3j_A* 3u3r_A* 1z28_A* 3qvv_A* 3qvu_A* 1z29_A* 1cjm_A 2a3r_A* Back     alignment and structure
>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics conso transferase; 2.24A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1ls6a_288 c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human 1e-06
d1j99a_284 c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult 5e-06
d3bfxa1285 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Huma 1e-05
d2z5fa_293 c.37.1.5 (A:) Thyroid hormone sulfotransferase Sul 2e-05
d1q20a_294 c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1 3e-05
d1g3ma_290 c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult 7e-05
d1fmja_342 c.37.1.5 (A:) Retinol dehydratase {Fall armyworm ( 1e-04
d1q44a_320 c.37.1.5 (A:) Putative steroid sulfotransferase ra 2e-04
>d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: PAPS sulfotransferase
domain: Aryl sulfotransferase sult1a
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.6 bits (102), Expect = 1e-06
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 4   VHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDK 63
           + ++ K  IQ+  +F+ H L    +  +  H SF+ MK+N  TNY  V +   +++    
Sbjct: 189 MKENPKREIQKILEFVGHSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHS---- 244

Query: 64  EKCERGAFMRSGKIGG 79
                  FMR G  G 
Sbjct: 245 ----ISPFMRKGMAGD 256


>d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure
>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Length = 342 Back     information, alignment and structure
>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d3bfxa1285 Sulfotransferase Sult1c2 {Human (Homo sapiens) [Ta 99.88
d1fmja_342 Retinol dehydratase {Fall armyworm (Spodoptera fru 99.87
d1ls6a_288 Aryl sulfotransferase sult1a {Human (Homo sapiens) 99.87
d2z5fa_293 Thyroid hormone sulfotransferase Sult1b1 {Human (H 99.87
d1q44a_320 Putative steroid sulfotransferase rarO47 {Thale cr 99.86
d1q20a_294 Cholesterol sulfotransferase sult2b1b {Human (Homo 99.85
d1j99a_284 Hydroxysteroid sulfotransferase sult2a1 {Human (Ho 99.84
d1g3ma_290 Estrogen sulfotransferase (STE, sult1e1) {Human (H 99.84
d1texa_265 Stf0 sulfotransferase {Mycobacterium smegmatis [Ta 96.91
d1t8ta_271 Heparan sulfate glucosamine 3-O-sulfotransferase 3 96.48
d1vkja_258 Heparan sulfate 3-O-sulfotransferase {Mouse (Mus m 96.24
d1nsta_301 Heparan sulfate N-deacetylase/N-sulfotransferase d 96.14
d1q44a_ 320 Putative steroid sulfotransferase rarO47 {Thale cr 87.81
d1jjcb275 Domains B1 and B5 of PheRS-beta, PheT {Thermus the 80.48
>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: PAPS sulfotransferase
domain: Sulfotransferase Sult1c2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=2e-24  Score=159.04  Aligned_cols=93  Identities=22%  Similarity=0.337  Sum_probs=69.5

Q ss_pred             CchhhHhHHHHHHHHHhhcCCCCCHHHHHHHHHhcChHHHhhchhhhhhHHHhhhhcccccccccccccceEEecccCCC
Q psy10123          1 MLSVHQDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGL   80 (123)
Q Consensus         1 ~Edlk~d~~~~v~ria~Flg~~~~~~~l~~iv~~~sfe~Mk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fvRkG~vGdW   80 (123)
                      ||||++|+.++|++||+|||++++++.++.|+++|||++||++...+...+..     ...+.+   ...|||+|.+|+|
T Consensus       183 YEdL~~d~~~~v~kI~~FLg~~~~~~~i~~i~~~~sF~~mk~~e~~~~~~~~~-----~~~~~~---~~~FfRkG~~G~W  254 (285)
T d3bfxa1         183 YEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSK-----SILDQS---ISSFMRKGTVGDW  254 (285)
T ss_dssp             HHHHHHCHHHHHHHHHHHTTCCCCHHHHHHHHHHTSHHHHHHC---------------------------CCCCCCSCTH
T ss_pred             HhHHhhhHHHHHHHHHHhhcccccHHHHHHHHHHcCHHHHHhhHHhccccccc-----ccccCC---CCCeeeCCCCCCc
Confidence            89999999999999999999999999999999999999999987665443211     112222   5689999999999


Q ss_pred             ccccccccccccCCCCccchhcCCC
Q psy10123         81 PVYVRDSVGHISNLPGRRFIKAHLP  105 (123)
Q Consensus        81 k~~ft~e~~~~~~~~~pr~i~~hl~  105 (123)
                      |++||++|.++|+    ++++.+|.
T Consensus       255 k~~~s~eq~~~~~----~~~~e~m~  275 (285)
T d3bfxa1         255 KNHFTVAQNERFD----EIYRRKME  275 (285)
T ss_dssp             HHHCCHHHHHHHH----HHHHHHHT
T ss_pred             hhhCCHHHHHHHH----HHHHHHhC
Confidence            9999999999999    55555443



>d1fmja_ c.37.1.5 (A:) Retinol dehydratase {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d1ls6a_ c.37.1.5 (A:) Aryl sulfotransferase sult1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3ma_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1texa_ c.37.1.5 (A:) Stf0 sulfotransferase {Mycobacterium smegmatis [TaxId: 1772]} Back     information, alignment and structure
>d1t8ta_ c.37.1.5 (A:) Heparan sulfate glucosamine 3-O-sulfotransferase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkja_ c.37.1.5 (A:) Heparan sulfate 3-O-sulfotransferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nsta_ c.37.1.5 (A:) Heparan sulfate N-deacetylase/N-sulfotransferase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jjcb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure