Diaphorina citri psyllid: psy10129


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
IRHAINKNNISIREVTEKCLSRIEEVSKLNAFITVTKNEALCKATEIVKDEKTMLQGVTVAIKDNFCTRGIPTTCASKMLENFIAPYDATVVEKLKQSGAIIVGKTNMDEFAMGLVVRILWLGLQSEFKLCLSYL
cHHHHHcccccHHHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHcccccccccccEEEHHHHHccccccccHHHHHccccccccHHHHHHHHHHccccccccccHHHccccccccccccccccccccccccc
*******NNISIREVTEKCLSRIEEVSKLNAFITVTKNEALCKATEIVKDEKTMLQGVTVAIKDNFCTRGIPTTCASKMLENFIAPYDATVVEKLKQSGAIIVGKTNMDEFAMGLVVRILWLGLQSEFKLCLS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IRHAINKNNISIREVTEKCLSRIEEVSKLNAFITVTKNEALCKATEIVKDEKTMLQGVTVAIKDNFCTRGIPTTCASKMLENFIAPYDATVVEKLKQSGAIIVGKTNMDEFAMGLVVRILWLGLQSEFKLCLSYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamyl-tRNA(Gln) amidotransferase subunit A Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).confidentB9LZ18
Glutamyl-tRNA(Gln) amidotransferase subunit A Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).confidentA6TTJ8
Glutamyl-tRNA(Gln) amidotransferase subunit A Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).confidentQ3AD36

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0016811 [MF]hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidesprobableGO:0016787, GO:0016810, GO:0003674, GO:0003824
GO:0046483 [BP]heterocycle metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006725 [BP]cellular aromatic compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0L, chain A
Confidence level:very confident
Coverage over the Query: 1-133
View the alignment between query and template
View the model in PyMOL