Diaphorina citri psyllid: psy1013

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26

MKILADLDLNLIGDFSKQFILPLVPDGKHHDLKNISPDTLARLIRGEFNDVVDKYLIIDCRYPYEYKGGHIQGALNIYTREHLVKEFIESKVHAQSNATCDKRRVLIFHCEYSAERGPTLSRYLRSEDRAHNAYPTLDYPEMYLLNGGYKQFYAQHQDLCEGGYLPMADPGYKSRYLRSEDRAHNAYPTLDYPEMYLLNGGYKQFYAQHQDLCEGGYLPMADPGYKSDFQTFRSKSKTWSCDYKANKSLSKPRKRLGI

ccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEECcccccccccEEEEccccccHHHHHHHHHHHHHHHcccccccccEEEEEEEccccccHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHcccccccccCCccccccHHHHHHHHHHHHccccccccccHHccccccHHHHHHHccccccccccccccccccccHHHHccccccccccccccccccccccccc

*******DLNLIGDFSKQFILPLVPDGKHHDLKNISPDTLARLIRGEFNDVVDKYLIIDCRYPYEYKGGHIQGALNIYTREHLVKEFIESKVHAQSNATCDKRRVLIFHCEYSAERGPTLSRYLRSEDRAHNAYPTLDYPEMYLLNGGYKQFYAQHQDLCEGGYLPMADPGYKSRYLRSEDRAHNAYPTLDYPEMYLLNGGYKQFYAQHQDLCEGGYLPMADPGYKSDFQTF******WSC*****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
M-phase inducer phosphatase	This protein functions as a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It may directly dephosphorylate p34(cdc2) and activate the p34(cdc2) kinase activity.	confident	P20483

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022402 [BP]	cell cycle process	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0006468 [BP]	protein phosphorylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0000278 [BP]	mitotic cell cycle	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0000922 [CC]	spindle pole	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004725 [MF]	protein tyrosine phosphatase activity	probable	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005694 [CC]	chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QB0, chain A
Confidence level:very confident
Coverage over the Query: 7-161,214-240
View the alignment between query and template
View the model in PyMOL

Template: 3OLH, chain A
Confidence level:confident
Coverage over the Query: 33-127,138-206
View the alignment between query and template
View the model in PyMOL