Diaphorina citri psyllid: psy10162


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MHAPRPDQRRADLGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKIDLETKPDKLAS
ccccccccccHcccccccccccccccccccccccccccEEEEccccccccEEEEccccccccccccHHHHHHHccccccccccccccccccccEEEEEEccccccEEEEEEEEEcccccccccHHHHHHcccccccccccc
**************ASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKID***KPD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHAPRPDQRRADLGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKIDLETKPDKLAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004867 [MF]serine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0044562 [BP]envenomation resulting in negative regulation of voltage-gated potassium channel activity in other organismprobableGO:0044559, GO:0050896, GO:0007610, GO:0008150, GO:0044560, GO:0035737, GO:0035738, GO:0051705, GO:0051704
GO:0008200 [MF]ion channel inhibitor activityprobableGO:0016247, GO:0003674, GO:0016248
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BIK, chain A
Confidence level:very confident
Coverage over the Query: 23-133
View the alignment between query and template
View the model in PyMOL