Psyllid ID: psy10162
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 141 | ||||||
| 307206898 | 2983 | Papilin [Harpegnathos saltator] | 0.524 | 0.024 | 0.461 | 7e-13 | |
| 307185838 | 2944 | Papilin [Camponotus floridanus] | 0.695 | 0.033 | 0.345 | 9e-12 | |
| 383852694 | 2894 | PREDICTED: papilin-like [Megachile rotun | 0.439 | 0.021 | 0.516 | 1e-11 | |
| 332020126 | 2748 | Papilin [Acromyrmex echinatior] | 0.397 | 0.020 | 0.492 | 3e-11 | |
| 350422357 | 2962 | PREDICTED: LOW QUALITY PROTEIN: papilin- | 0.439 | 0.020 | 0.476 | 6e-10 | |
| 321473765 | 2763 | hypothetical protein DAPPUDRAFT_314628 [ | 0.510 | 0.026 | 0.4 | 6e-10 | |
| 340713638 | 3067 | PREDICTED: papilin-like [Bombus terrestr | 0.439 | 0.020 | 0.476 | 1e-09 | |
| 345489863 | 2588 | PREDICTED: papilin-like [Nasonia vitripe | 0.496 | 0.027 | 0.493 | 7e-09 | |
| 380025477 | 2813 | PREDICTED: papilin-like [Apis florea] | 0.390 | 0.019 | 0.466 | 2e-08 | |
| 6164595 | 3198 | lacunin [Manduca sexta] | 0.319 | 0.014 | 0.565 | 4e-08 |
| >gi|307206898|gb|EFN84744.1| Papilin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 79.0 bits (193), Expect = 7e-13, Method: Compositional matrix adjust.
Identities = 36/78 (46%), Positives = 51/78 (65%)
Query: 26 IVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGS 85
+ D G +G F K+Y++P T SC+EF YGGC G+ANRFSTI ECES C QEE +P G+
Sbjct: 2296 LPVDSGPCRGAFRKYYYEPSTRSCREFTYGGCDGNANRFSTIPECESICIHQEEPVPPGN 2355
Query: 86 NSTEARSGIIIWAMNKAS 103
+++ + I ++ S
Sbjct: 2356 DTSVSNLSICKEPVDSGS 2373
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307185838|gb|EFN71679.1| Papilin [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383852694|ref|XP_003701860.1| PREDICTED: papilin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332020126|gb|EGI60570.1| Papilin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350422357|ref|XP_003493139.1| PREDICTED: LOW QUALITY PROTEIN: papilin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|321473765|gb|EFX84732.1| hypothetical protein DAPPUDRAFT_314628 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|340713638|ref|XP_003395347.1| PREDICTED: papilin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345489863|ref|XP_001601735.2| PREDICTED: papilin-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|380025477|ref|XP_003696500.1| PREDICTED: papilin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|6164595|gb|AAF04457.1|AF078161_1 lacunin [Manduca sexta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 141 | ||||||
| UNIPROTKB|E1BUM2 | 308 | TFPI "Uncharacterized protein" | 0.453 | 0.207 | 0.375 | 1.4e-10 | |
| UNIPROTKB|Q7YRQ8 | 234 | TFPI2 "Tissue factor pathway i | 0.397 | 0.239 | 0.428 | 4.6e-10 | |
| FB|FBgn0039077 | 119 | CG17380 [Drosophila melanogast | 0.446 | 0.529 | 0.439 | 6.6e-10 | |
| ZFIN|ZDB-GENE-030711-1 | 292 | tfpia "tissue factor pathway i | 0.382 | 0.184 | 0.462 | 7e-10 | |
| UNIPROTKB|C9JKV3 | 215 | TFPI "Tissue factor pathway in | 0.368 | 0.241 | 0.384 | 1.8e-09 | |
| UNIPROTKB|E1BVF2 | 239 | TFPI2 "Uncharacterized protein | 0.730 | 0.430 | 0.327 | 2.1e-09 | |
| UNIPROTKB|K7EKZ2 | 158 | K7EKZ2 "Uncharacterized protei | 0.439 | 0.392 | 0.406 | 2.9e-09 | |
| UNIPROTKB|K7EQZ3 | 153 | K7EQZ3 "Uncharacterized protei | 0.439 | 0.405 | 0.406 | 2.9e-09 | |
| UNIPROTKB|P86733 | 126 | P86733 "BPTI/Kunitz domain-con | 0.531 | 0.595 | 0.384 | 3.6e-09 | |
| UNIPROTKB|P86862 | 65 | P86862 "Toxin APEKTx1" [Anthop | 0.354 | 0.769 | 0.44 | 3.6e-09 |
| UNIPROTKB|E1BUM2 TFPI "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 153 (58.9 bits), Expect = 1.4e-10, P = 1.4e-10
Identities = 24/64 (37%), Positives = 41/64 (64%)
Query: 29 DPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNST 88
DPG +G FS+++++ +T C+ F+YGGC G+ N F ++EEC++ C +LP N
Sbjct: 129 DPGICRGFFSRYFYNKETKICEIFKYGGCLGNQNNFKSLEECQTTCQGNLNLLPTAPNEE 188
Query: 89 EARS 92
E+ +
Sbjct: 189 ESHT 192
|
|
| UNIPROTKB|Q7YRQ8 TFPI2 "Tissue factor pathway inhibitor 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039077 CG17380 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030711-1 tfpia "tissue factor pathway inhibitor a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JKV3 TFPI "Tissue factor pathway inhibitor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVF2 TFPI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EKZ2 K7EKZ2 "Uncharacterized protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EQZ3 K7EQZ3 "Uncharacterized protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P86733 P86733 "BPTI/Kunitz domain-containing protein" [Haliotis asinina (taxid:109174)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P86862 P86862 "Toxin APEKTx1" [Anthopleura elegantissima (taxid:6110)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 141 | |||
| pfam00014 | 53 | pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t | 1e-17 | |
| smart00131 | 53 | smart00131, KU, BPTI/Kunitz family of serine prote | 1e-17 | |
| cd00109 | 54 | cd00109, KU, BPTI/Kunitz family of serine protease | 3e-16 |
| >gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain | Back alignment and domain information |
|---|
Score = 70.8 bits (174), Expect = 1e-17
Identities = 22/48 (45%), Positives = 32/48 (66%)
Query: 28 ADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCF 75
DPG +G+ ++Y++P T C+ F YGGC G+AN F ++EECE C
Sbjct: 6 PDPGPCRGSIPRWYYNPSTGQCEPFIYGGCGGNANNFESLEECEKACR 53
|
Indicative of a protease inhibitor, usually a serine protease inhibitor. Structure is a disulfide rich alpha+beta fold. BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. Certain family members are similar to the tick anticoagulant peptide (TAP). This is a highly selective inhibitor of factor Xa in the blood coagulation pathways. TAP molecules are highly dipolar, and are arranged to form a twisted two- stranded antiparallel beta-sheet followed by an alpha helix. Length = 53 |
| >gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| cd00109 | 54 | KU BPTI/Kunitz family of serine protease inhibitor | 99.71 | |
| smart00131 | 53 | KU BPTI/Kunitz family of serine protease inhibitor | 99.7 | |
| PF00014 | 53 | Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi | 99.69 | |
| KOG4295|consensus | 295 | 99.32 | ||
| cd00109 | 54 | KU BPTI/Kunitz family of serine protease inhibitor | 98.85 | |
| smart00131 | 53 | KU BPTI/Kunitz family of serine protease inhibitor | 98.84 | |
| PF00014 | 53 | Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi | 98.74 | |
| KOG4295|consensus | 295 | 98.72 | ||
| KOG4597|consensus | 560 | 98.57 | ||
| KOG4597|consensus | 560 | 97.11 | ||
| KOG3540|consensus | 615 | 93.42 |
| >cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
Probab=99.71 E-value=1.7e-17 Score=100.45 Aligned_cols=54 Identities=41% Similarity=0.862 Sum_probs=51.8
Q ss_pred CCccCCCCCCCCCCCeeeEEEeCCCCCceEeecCCCCCCCCCCCcHHHHHHhcc
Q psy10162 22 GFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCF 75 (141)
Q Consensus 22 ~~C~~p~~~g~C~~~~~rw~yd~~~~~C~~F~~~gC~gn~N~F~t~~~C~~~C~ 75 (141)
++|.+|++.|.|...+++||||+.+++|+.|.|+||++|.|+|.|+++|+++|.
T Consensus 1 ~~C~~~~~~g~C~~~~~~~~yd~~~~~C~~f~~~gc~~~~N~F~s~~~C~~~C~ 54 (54)
T cd00109 1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG 54 (54)
T ss_pred CcccCCCCCCCCCCCccEEEEeCCCCccceeECCCccCCccCcCCHHHHHhhcc
Confidence 479999999999999999999999999999999999999999999999999984
|
BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. |
| >smart00131 KU BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus | Back alignment and domain information |
|---|
| >KOG4295|consensus | Back alignment and domain information |
|---|
| >cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
| >smart00131 KU BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus | Back alignment and domain information |
|---|
| >KOG4295|consensus | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >KOG3540|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 141 | ||||
| 3byb_A | 59 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 7e-09 | ||
| 3d65_I | 57 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 7e-09 | ||
| 4dtg_K | 66 | Hemostatic Effect Of A Monoclonal Antibody Mab 2021 | 2e-08 | ||
| 1tfx_C | 58 | Complex Of The Second Kunitz Domain Of Tissue Facto | 2e-08 | ||
| 1adz_A | 71 | The Solution Structure Of The Second Kunitz Domain | 3e-08 | ||
| 2ody_E | 127 | Thrombin-bound Boophilin Displays A Functional And | 3e-08 | ||
| 2kcr_A | 61 | Solution Structure Of Anntoxin Length = 61 | 4e-08 | ||
| 1zr0_B | 63 | Crystal Structure Of Kunitz Domain 1 Of Tissue Fact | 2e-07 | ||
| 1kth_A | 58 | The Anisotropic Refinement Of Kunitz Type Domain C5 | 5e-07 | ||
| 1jc6_A | 65 | Solution Structure Of Bungarus Faciatus Ix, A Kunit | 3e-06 | ||
| 1dem_A | 60 | Proteinase Inhibitor Homologues As Potassium Channe | 4e-06 | ||
| 1dtx_A | 59 | Crystal Structure Of Alpha-Dendrotoxin From The Gre | 8e-06 | ||
| 1yc0_I | 75 | Short Form Hgfa With First Kunitz Domain From Hai-1 | 3e-05 | ||
| 1bf0_A | 60 | Calcicludine (Cac) From Green Mamba Dendroaspis Ang | 4e-05 | ||
| 1dtk_A | 57 | The Nmr Solution Structure Of Dendrotoxin K From Th | 6e-05 | ||
| 2jot_A | 55 | Nuclear Magnetic Resonance Studies On Huwentoxin-Xi | 8e-05 | ||
| 1irh_A | 61 | The Solution Structure Of The Third Kunitz Domain O | 1e-04 | ||
| 3l3t_E | 57 | Human Mesotrypsin Complexed With Amyloid Precursor | 2e-04 | ||
| 1aap_A | 58 | X-Ray Crystal Structure Of The Protease Inhibitor D | 3e-04 | ||
| 1zjd_B | 57 | Crystal Structure Of The Catalytic Domain Of Coagul | 3e-04 | ||
| 1brc_I | 56 | Relocating A Negative Charge In The Binding Pocket | 3e-04 | ||
| 3l33_E | 52 | Human Mesotrypsin Complexed With Amyloid Precursor | 4e-04 | ||
| 1bik_A | 147 | X-Ray Structure Of Bikunin From The Human Inter-Alp | 4e-04 | ||
| 1ca0_D | 54 | Bovine Chymotrypsin Complexed To Appi Length = 54 | 4e-04 |
| >pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 | Back alignment and structure |
|
| >pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 | Back alignment and structure |
| >pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 | Back alignment and structure |
| >pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 | Back alignment and structure |
| >pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 | Back alignment and structure |
| >pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 | Back alignment and structure |
| >pdb|2KCR|A Chain A, Solution Structure Of Anntoxin Length = 61 | Back alignment and structure |
| >pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 | Back alignment and structure |
| >pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 | Back alignment and structure |
| >pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 | Back alignment and structure |
| >pdb|1DEM|A Chain A, Proteinase Inhibitor Homologues As Potassium Channel Blockers Length = 60 | Back alignment and structure |
| >pdb|1DTX|A Chain A, Crystal Structure Of Alpha-Dendrotoxin From The Green Mamba Venom And Its Comparison With The Structure Of Bovine Pancreatic Trypsin Inhibitor Length = 59 | Back alignment and structure |
| >pdb|1YC0|I Chain I, Short Form Hgfa With First Kunitz Domain From Hai-1 Length = 75 | Back alignment and structure |
| >pdb|1BF0|A Chain A, Calcicludine (Cac) From Green Mamba Dendroaspis Angusticeps, Nmr, 15 Structures Length = 60 | Back alignment and structure |
| >pdb|1DTK|A Chain A, The Nmr Solution Structure Of Dendrotoxin K From The Venom Of Dendroaspis Polylepis Polylepis Length = 57 | Back alignment and structure |
| >pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 | Back alignment and structure |
| >pdb|1IRH|A Chain A, The Solution Structure Of The Third Kunitz Domain Of Tissue Factor Pathway Inhibitor Length = 61 | Back alignment and structure |
| >pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 | Back alignment and structure |
| >pdb|1AAP|A Chain A, X-Ray Crystal Structure Of The Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor Length = 58 | Back alignment and structure |
| >pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 | Back alignment and structure |
| >pdb|1BRC|I Chain I, Relocating A Negative Charge In The Binding Pocket Of Trypsin Length = 56 | Back alignment and structure |
| >pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 | Back alignment and structure |
| >pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 | Back alignment and structure |
| >pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 141 | |||
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} Length = 6 | 3e-18 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 4e-18 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 7e-18 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 1e-17 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 1e-17 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 1e-17 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 2e-17 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 2e-17 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 2e-17 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 3e-17 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 3e-17 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 3e-17 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 4e-17 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 4e-17 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 4e-17 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 5e-17 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 6e-17 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 6e-17 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 7e-17 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 8e-17 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 2e-16 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 3e-16 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 1e-14 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 2e-15 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 4e-15 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 9e-14 |
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 | Back alignment and structure |
|---|
Score = 72.0 bits (177), Expect = 3e-18
Identities = 23/51 (45%), Positives = 33/51 (64%)
Query: 28 ADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQE 78
+ G G+F+ +Y+D TSSC+ FRY G G+ NRF T+E+CE+ C E
Sbjct: 11 RNYGKGSGSFTNYYYDKATSSCKTFRYRGSGGNGNRFKTLEDCEATCVTAE 61
|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 | Back alignment and structure |
|---|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 | Back alignment and structure |
|---|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 99.97 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 99.97 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 99.85 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.84 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.84 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 99.84 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 99.84 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 99.84 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 99.84 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 99.84 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 99.83 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 99.83 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 99.83 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} | 99.83 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 99.83 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 99.83 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 99.83 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 99.83 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 99.83 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 99.83 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 99.82 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 99.82 | |
| 1toc_R | 120 | Ornithodorin; vitamin K, zymogen, gamma-carboxyglu | 99.82 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 99.81 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 99.77 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 99.7 | |
| 1toc_R | 120 | Ornithodorin; vitamin K, zymogen, gamma-carboxyglu | 99.69 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 99.69 | |
| 2uuy_B | 52 | Tryptase inhibitor; calcium, zymogen, protease, hy | 99.68 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 99.34 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 99.32 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 99.31 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 99.31 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.3 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 99.3 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 99.29 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 99.29 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 99.28 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.28 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 99.28 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 99.27 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 99.27 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 99.25 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 99.25 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 99.25 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 99.25 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 99.24 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 99.24 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} | 99.23 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 99.2 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 99.14 | |
| 2uuy_B | 52 | Tryptase inhibitor; calcium, zymogen, protease, hy | 98.88 | |
| 2w8x_A | 72 | ION-channel modulator raklp; salivary gland, kunit | 92.0 | |
| 1d0d_A | 60 | TAP, anticoagulant protein; factor XA inhibitor, k | 89.03 |
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} | Back alignment and structure |
|---|
Probab=99.97 E-value=5.9e-32 Score=189.83 Aligned_cols=110 Identities=30% Similarity=0.558 Sum_probs=97.7
Q ss_pred CcCCccCCCCCCCCCCCeeeEEEeCCCCCceEeecCCCCCCCCCCCcHHHHHHhccccCC-----------CCCCCCCCC
Q psy10162 20 LAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEE-----------ILPVGSNST 88 (141)
Q Consensus 20 ~~~~C~~p~~~g~C~~~~~rw~yd~~~~~C~~F~~~gC~gn~N~F~t~~~C~~~C~~~~~-----------~~p~~~~~~ 88 (141)
.+++|.+|++.|+|.+.++|||||+.+++|+.|.|+||+||.|+|.|+++|+++|..... .+.++...+
T Consensus 2 ~~~~C~~p~~~G~C~~~~~r~~yn~~t~~C~~F~y~GC~gN~N~F~t~~~C~~~C~~~~~~~~~~~~~~~~~C~~p~~~G 81 (127)
T 2ody_E 2 RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVNDFESADFKTGCEPAADSG 81 (127)
T ss_dssp CBGGGGSCCCCCSSCCCEEEEEEETTTTEEEEEEECSSCCCSSCBSSHHHHHHHHSSCCCCCCCCCCCHHHHTSSCCCCC
T ss_pred CCCcccCCCCCccCcCceeeEEEECCCCeeeEeecCCcCCCccccCcHHHHHHhccccccccccccCCcCCcCCCcCCCC
Confidence 468899999999999999999999999999999999999999999999999999998542 233444567
Q ss_pred CCCCCeeEEEEeCCCCceEEEecceecCCCCCcccc---ccccccCC
Q psy10162 89 EARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQ---DYCTKIDL 132 (141)
Q Consensus 89 ~c~~~~~rw~yd~~~~~C~~c~~f~yggc~gn~n~f---~~C~~~~~ 132 (141)
.|++.++|||||+.+++ |..|+|+||+||.|+| ++|++.|.
T Consensus 82 ~C~~~~~r~~yd~~~~~---C~~F~Y~GC~GN~N~F~t~~eC~~~C~ 125 (127)
T 2ody_E 82 SCAGQLERWFYNVQSGE---CETFVYGGCGGNDNNYESEEECELVCK 125 (127)
T ss_dssp SSCCCEEEEEEETTTTE---EEEEEECSSCCCSCCBSSHHHHHHHHS
T ss_pred cccCcceeEEECCCCCc---eeEEEECCcCCCCcCcCCHHHHHHHcc
Confidence 89999999999999999 8999999999999996 56766654
|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} | Back alignment and structure |
|---|
| >1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 | Back alignment and structure |
|---|
| >2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A | Back alignment and structure |
|---|
| >2w8x_A ION-channel modulator raklp; salivary gland, kunitz domains, maxik channel activation, sulphur SAD, membrane protein; 1.60A {Rhipicephalus appendiculatus} | Back alignment and structure |
|---|
| >1d0d_A TAP, anticoagulant protein; factor XA inhibitor, kunitz inhibitor, blood clotting inhibitor; 1.62A {Ornithodoros moubata} SCOP: g.8.1.2 PDB: 1kig_I 1tap_A 1tcp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 141 | ||||
| d1zr0b1 | 63 | g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor | 7e-17 | |
| d1ktha_ | 58 | g.8.1.1 (A:) Collagen type VI (domain C5 from alph | 3e-16 | |
| d1dtxa_ | 59 | g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr | 3e-16 | |
| d1irha_ | 61 | g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma | 4e-16 | |
| d1bika2 | 56 | g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi | 4e-16 | |
| d1dtka_ | 57 | g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp | 4e-16 | |
| d1aapa_ | 56 | g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs | 5e-16 | |
| d1bf0a_ | 60 | g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend | 6e-16 | |
| d1shpa_ | 55 | g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich | 9e-16 | |
| d1tfxc_ | 58 | g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma | 9e-16 | |
| d1g6xa_ | 58 | g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C | 9e-16 | |
| d1bika1 | 54 | g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit | 1e-15 | |
| d1jc6a_ | 65 | g.8.1.1 (A:) Venom basic protease inhibitor IX (VI | 1e-15 | |
| d1bunb_ | 61 | g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain | 2e-15 |
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
class: Small proteins fold: BPTI-like superfamily: BPTI-like family: Small Kunitz-type inhibitors & BPTI-like toxins domain: Tissue factor pathway inhibitor species: Human (Homo sapiens) [TaxId: 9606]
Score = 67.6 bits (165), Expect = 7e-17
Identities = 21/51 (41%), Positives = 31/51 (60%)
Query: 28 ADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQE 78
D G + ++Y+D T SC++F YGGC G+AN F T E C+ C++ E
Sbjct: 13 LDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIE 63
|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| d1aapa_ | 56 | Alzheimer's amyloid B-protein precursor, APPI {Hum | 99.86 | |
| d1dtxa_ | 59 | alpha-Dendrotoxin {Green mamba (Dendroaspis angust | 99.85 | |
| d1shpa_ | 55 | Trypsin inhibitor {Sea anemone (Stichodactyla heli | 99.84 | |
| d1ktha_ | 58 | Collagen type VI (domain C5 from alpha 3 chain) {H | 99.84 | |
| d1bika2 | 56 | Bikunin from inter-alpha-inhibitor complex {Human | 99.84 | |
| d1dtka_ | 57 | Dendrotoxin K {Black mamba (Dendroaspis polylepis | 99.83 | |
| d1bika1 | 54 | Bikunin from inter-alpha-inhibitor complex {Human | 99.83 | |
| d1g6xa_ | 58 | Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru | 99.83 | |
| d1zr0b1 | 63 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.83 | |
| d1tfxc_ | 58 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.83 | |
| d1bunb_ | 61 | beta2-bungarotoxin, neurotoxin chain {Many-banded | 99.83 | |
| d1irha_ | 61 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.82 | |
| d1jc6a_ | 65 | Venom basic protease inhibitor IX (VIIIb) {Banded | 99.81 | |
| d1bf0a_ | 60 | Calcicludine (cac) {Green mamba (Dendroaspis angus | 99.81 | |
| d1dtxa_ | 59 | alpha-Dendrotoxin {Green mamba (Dendroaspis angust | 99.36 | |
| d1bunb_ | 61 | beta2-bungarotoxin, neurotoxin chain {Many-banded | 99.36 | |
| d1bika1 | 54 | Bikunin from inter-alpha-inhibitor complex {Human | 99.35 | |
| d1bika2 | 56 | Bikunin from inter-alpha-inhibitor complex {Human | 99.34 | |
| d1dtka_ | 57 | Dendrotoxin K {Black mamba (Dendroaspis polylepis | 99.33 | |
| d1zr0b1 | 63 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.33 | |
| d1aapa_ | 56 | Alzheimer's amyloid B-protein precursor, APPI {Hum | 99.33 | |
| d1ktha_ | 58 | Collagen type VI (domain C5 from alpha 3 chain) {H | 99.31 | |
| d1shpa_ | 55 | Trypsin inhibitor {Sea anemone (Stichodactyla heli | 99.3 | |
| d1bf0a_ | 60 | Calcicludine (cac) {Green mamba (Dendroaspis angus | 99.27 | |
| d1jc6a_ | 65 | Venom basic protease inhibitor IX (VIIIb) {Banded | 99.26 | |
| d1irha_ | 61 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.25 | |
| d1tfxc_ | 58 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.23 | |
| d1g6xa_ | 58 | Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru | 99.22 | |
| d1tocr2 | 63 | Ornithodorin {Soft tick (Ornithodoros moubata) [Ta | 97.06 | |
| d1d0da_ | 60 | Anticoagulant protein, factor Xa inhibitor {Soft t | 89.07 |
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: BPTI-like superfamily: BPTI-like family: Small Kunitz-type inhibitors & BPTI-like toxins domain: Alzheimer's amyloid B-protein precursor, APPI species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86 E-value=2.7e-22 Score=120.28 Aligned_cols=56 Identities=34% Similarity=0.678 Sum_probs=53.9
Q ss_pred CcCCccCCCCCCCCCCCeeeEEEeCCCCCceEeecCCCCCCCCCCCcHHHHHHhcc
Q psy10162 20 LAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCF 75 (141)
Q Consensus 20 ~~~~C~~p~~~g~C~~~~~rw~yd~~~~~C~~F~~~gC~gn~N~F~t~~~C~~~C~ 75 (141)
++++|++|++.|+|...++|||||+.+++|+.|.|+||+||.|+|.|+++|++.|.
T Consensus 1 v~d~C~~p~~~G~C~~~~~rwyyd~~~~~C~~F~y~GCgGN~NnF~t~~~C~~~CG 56 (56)
T d1aapa_ 1 VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG 56 (56)
T ss_dssp CGGGGGBCCCCCSSSCCEEEEEEETTTTEEEEEEECSSSCCSCCBSSHHHHHHHHC
T ss_pred CCcccCCCCCCcCCCCceeEEEEECCCCcEeeeEcCCccCCccCcCCHHHHHHhhC
Confidence 46899999999999999999999999999999999999999999999999999985
|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} | Back information, alignment and structure |
|---|
| >d1d0da_ g.8.1.2 (A:) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata) [TaxId: 6938]} | Back information, alignment and structure |
|---|