Psyllid ID: psy10162


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MHAPRPDQRRADLGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKIDLETKPDKLAS
cccccccccHHHccccccccccccccccccccccccccEEEEccccccccEEEEccccccccccccHHHHHHHccccccccccccccccccccEEEEEEccccccEEEEEEEEEcccccccccHHHHHHHccccccccccc
ccccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEEccccccccccccHHHHHHHHccccccccccccccccccccEEEEEcccccEEEEEEEcccccccccccHHHHccccccccccccccc
mhaprpdqrradlgASCTVLAGFHLivadpghvkgnfskfyfdpdtsscqefryggcpgsanrfstIEECESfcfkqeeilpvgsnsteaRSGIIIWAMNKASTKFHVILGLLYknrsgdktrqdyctkidletkpdklas
mhaprpdqrradLGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKqeeilpvgsnSTEARSGIIIWAMNKASTKFHVILGLLyknrsgdktrqdyctkidletkpdklas
MHAPRPDQRRADLGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKIDLETKPDKLAS
************LGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRS******DYCT*************
**********************FHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKID***KPD****
**********ADLGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKIDLETKPDKLAS
**************ASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKIDL*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHAPRPDQRRADLGASCTVLAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNSTEARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQDYCTKIDLETKPDKLAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
B5L5R783 Protease inhibitor stephe N/A N/A 0.368 0.626 0.538 7e-10
B5KL4083 Protease inhibitor superb N/A N/A 0.368 0.626 0.519 7e-09
Q6ITC183 Protease inhibitor mulgin N/A N/A 0.368 0.626 0.5 8e-09
P0099190 Protease inhibitor 1 OS=V N/A N/A 0.368 0.577 0.461 1e-08
Q6ITB883 Protease inhibitor mulgin N/A N/A 0.368 0.626 0.5 1e-08
Q90W9883 Protease inhibitor textil N/A N/A 0.368 0.626 0.519 1e-08
B5KL3783 Protease inhibitor nigres N/A N/A 0.368 0.626 0.519 1e-08
B5KF9683 Protease inhibitor nigres N/A N/A 0.368 0.626 0.538 1e-08
B5L5R183 Blackelin-5 OS=Pseudechis N/A N/A 0.368 0.626 0.519 2e-08
Q6ITB783 Protease inhibitor scutel N/A N/A 0.368 0.626 0.538 2e-08
>sp|B5L5R7|IVBI2_HOPST Protease inhibitor stephenin-2 OS=Hoplocephalus stephensii PE=3 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 34/52 (65%)

Query: 23 FHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFC 74
          F  + AD G  KGNF  FY++PD   C EF YGGC G+AN F TI+EC+  C
Sbjct: 30 FCELPADSGSCKGNFQAFYYNPDQHQCLEFIYGGCDGNANNFKTIDECKRTC 81




Serine protease inhibitor.
Hoplocephalus stephensii (taxid: 196418)
>sp|B5KL40|IVBI3_AUSSU Protease inhibitor superbin-3 OS=Austrelaps superbus PE=2 SV=1 Back     alignment and function description
>sp|Q6ITC1|IVBI1_PSEAU Protease inhibitor mulgin-1 OS=Pseudechis australis PE=2 SV=1 Back     alignment and function description
>sp|P00991|IVBIT_VIPAM Protease inhibitor 1 OS=Vipera ammodytes PE=1 SV=2 Back     alignment and function description
>sp|Q6ITB8|IVBI4_PSEAU Protease inhibitor mulgin-4 OS=Pseudechis australis PE=2 SV=1 Back     alignment and function description
>sp|Q90W98|IVBI4_PSETT Protease inhibitor textilinin-4 OS=Pseudonaja textilis textilis PE=2 SV=1 Back     alignment and function description
>sp|B5KL37|IVBI6_RHING Protease inhibitor nigrescinin-6 OS=Rhinoplocephalus nigrescens PE=2 SV=1 Back     alignment and function description
>sp|B5KF96|IVBI2_RHING Protease inhibitor nigrescinin-2 OS=Rhinoplocephalus nigrescens PE=2 SV=1 Back     alignment and function description
>sp|B5L5R1|IVBI5_PSEPO Blackelin-5 OS=Pseudechis porphyriacus PE=3 SV=1 Back     alignment and function description
>sp|Q6ITB7|IVBS1_OXYSC Protease inhibitor scutellin-1 OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
307206898 2983 Papilin [Harpegnathos saltator] 0.524 0.024 0.461 7e-13
307185838 2944 Papilin [Camponotus floridanus] 0.695 0.033 0.345 9e-12
383852694 2894 PREDICTED: papilin-like [Megachile rotun 0.439 0.021 0.516 1e-11
332020126 2748 Papilin [Acromyrmex echinatior] 0.397 0.020 0.492 3e-11
350422357 2962 PREDICTED: LOW QUALITY PROTEIN: papilin- 0.439 0.020 0.476 6e-10
321473765 2763 hypothetical protein DAPPUDRAFT_314628 [ 0.510 0.026 0.4 6e-10
340713638 3067 PREDICTED: papilin-like [Bombus terrestr 0.439 0.020 0.476 1e-09
345489863 2588 PREDICTED: papilin-like [Nasonia vitripe 0.496 0.027 0.493 7e-09
380025477 2813 PREDICTED: papilin-like [Apis florea] 0.390 0.019 0.466 2e-08
6164595 3198 lacunin [Manduca sexta] 0.319 0.014 0.565 4e-08
>gi|307206898|gb|EFN84744.1| Papilin [Harpegnathos saltator] Back     alignment and taxonomy information
 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%)

Query: 26   IVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGS 85
            +  D G  +G F K+Y++P T SC+EF YGGC G+ANRFSTI ECES C  QEE +P G+
Sbjct: 2296 LPVDSGPCRGAFRKYYYEPSTRSCREFTYGGCDGNANRFSTIPECESICIHQEEPVPPGN 2355

Query: 86   NSTEARSGIIIWAMNKAS 103
            +++ +   I    ++  S
Sbjct: 2356 DTSVSNLSICKEPVDSGS 2373




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307185838|gb|EFN71679.1| Papilin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383852694|ref|XP_003701860.1| PREDICTED: papilin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332020126|gb|EGI60570.1| Papilin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350422357|ref|XP_003493139.1| PREDICTED: LOW QUALITY PROTEIN: papilin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|321473765|gb|EFX84732.1| hypothetical protein DAPPUDRAFT_314628 [Daphnia pulex] Back     alignment and taxonomy information
>gi|340713638|ref|XP_003395347.1| PREDICTED: papilin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345489863|ref|XP_001601735.2| PREDICTED: papilin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380025477|ref|XP_003696500.1| PREDICTED: papilin-like [Apis florea] Back     alignment and taxonomy information
>gi|6164595|gb|AAF04457.1|AF078161_1 lacunin [Manduca sexta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
UNIPROTKB|E1BUM2308 TFPI "Uncharacterized protein" 0.453 0.207 0.375 1.4e-10
UNIPROTKB|Q7YRQ8234 TFPI2 "Tissue factor pathway i 0.397 0.239 0.428 4.6e-10
FB|FBgn0039077119 CG17380 [Drosophila melanogast 0.446 0.529 0.439 6.6e-10
ZFIN|ZDB-GENE-030711-1 292 tfpia "tissue factor pathway i 0.382 0.184 0.462 7e-10
UNIPROTKB|C9JKV3215 TFPI "Tissue factor pathway in 0.368 0.241 0.384 1.8e-09
UNIPROTKB|E1BVF2239 TFPI2 "Uncharacterized protein 0.730 0.430 0.327 2.1e-09
UNIPROTKB|K7EKZ2158 K7EKZ2 "Uncharacterized protei 0.439 0.392 0.406 2.9e-09
UNIPROTKB|K7EQZ3153 K7EQZ3 "Uncharacterized protei 0.439 0.405 0.406 2.9e-09
UNIPROTKB|P86733126 P86733 "BPTI/Kunitz domain-con 0.531 0.595 0.384 3.6e-09
UNIPROTKB|P8686265 P86862 "Toxin APEKTx1" [Anthop 0.354 0.769 0.44 3.6e-09
UNIPROTKB|E1BUM2 TFPI "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 153 (58.9 bits), Expect = 1.4e-10, P = 1.4e-10
 Identities = 24/64 (37%), Positives = 41/64 (64%)

Query:    29 DPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEEILPVGSNST 88
             DPG  +G FS+++++ +T  C+ F+YGGC G+ N F ++EEC++ C     +LP   N  
Sbjct:   129 DPGICRGFFSRYFYNKETKICEIFKYGGCLGNQNNFKSLEECQTTCQGNLNLLPTAPNEE 188

Query:    89 EARS 92
             E+ +
Sbjct:   189 ESHT 192


GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA
GO:0007596 "blood coagulation" evidence=IEA
GO:0005615 "extracellular space" evidence=IEA
UNIPROTKB|Q7YRQ8 TFPI2 "Tissue factor pathway inhibitor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0039077 CG17380 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030711-1 tfpia "tissue factor pathway inhibitor a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C9JKV3 TFPI "Tissue factor pathway inhibitor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVF2 TFPI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|K7EKZ2 K7EKZ2 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EQZ3 K7EQZ3 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P86733 P86733 "BPTI/Kunitz domain-containing protein" [Haliotis asinina (taxid:109174)] Back     alignment and assigned GO terms
UNIPROTKB|P86862 P86862 "Toxin APEKTx1" [Anthopleura elegantissima (taxid:6110)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
pfam0001453 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t 1e-17
smart0013153 smart00131, KU, BPTI/Kunitz family of serine prote 1e-17
cd0010954 cd00109, KU, BPTI/Kunitz family of serine protease 3e-16
>gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain Back     alignment and domain information
 Score = 70.8 bits (174), Expect = 1e-17
 Identities = 22/48 (45%), Positives = 32/48 (66%)

Query: 28 ADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCF 75
           DPG  +G+  ++Y++P T  C+ F YGGC G+AN F ++EECE  C 
Sbjct: 6  PDPGPCRGSIPRWYYNPSTGQCEPFIYGGCGGNANNFESLEECEKACR 53


Indicative of a protease inhibitor, usually a serine protease inhibitor. Structure is a disulfide rich alpha+beta fold. BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. Certain family members are similar to the tick anticoagulant peptide (TAP). This is a highly selective inhibitor of factor Xa in the blood coagulation pathways. TAP molecules are highly dipolar, and are arranged to form a twisted two- stranded antiparallel beta-sheet followed by an alpha helix. Length = 53

>gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
cd0010954 KU BPTI/Kunitz family of serine protease inhibitor 99.71
smart0013153 KU BPTI/Kunitz family of serine protease inhibitor 99.7
PF0001453 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi 99.69
KOG4295|consensus295 99.32
cd0010954 KU BPTI/Kunitz family of serine protease inhibitor 98.85
smart0013153 KU BPTI/Kunitz family of serine protease inhibitor 98.84
PF0001453 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi 98.74
KOG4295|consensus 295 98.72
KOG4597|consensus 560 98.57
KOG4597|consensus560 97.11
KOG3540|consensus 615 93.42
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
Probab=99.71  E-value=1.7e-17  Score=100.45  Aligned_cols=54  Identities=41%  Similarity=0.862  Sum_probs=51.8

Q ss_pred             CCccCCCCCCCCCCCeeeEEEeCCCCCceEeecCCCCCCCCCCCcHHHHHHhcc
Q psy10162         22 GFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCF   75 (141)
Q Consensus        22 ~~C~~p~~~g~C~~~~~rw~yd~~~~~C~~F~~~gC~gn~N~F~t~~~C~~~C~   75 (141)
                      ++|.+|++.|.|...+++||||+.+++|+.|.|+||++|.|+|.|+++|+++|.
T Consensus         1 ~~C~~~~~~g~C~~~~~~~~yd~~~~~C~~f~~~gc~~~~N~F~s~~~C~~~C~   54 (54)
T cd00109           1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG   54 (54)
T ss_pred             CcccCCCCCCCCCCCccEEEEeCCCCccceeECCCccCCccCcCCHHHHHhhcc
Confidence            479999999999999999999999999999999999999999999999999984



BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure.

>smart00131 KU BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus Back     alignment and domain information
>KOG4295|consensus Back     alignment and domain information
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
>smart00131 KU BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus Back     alignment and domain information
>KOG4295|consensus Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG3540|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3byb_A59 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 7e-09
3d65_I57 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 7e-09
4dtg_K66 Hemostatic Effect Of A Monoclonal Antibody Mab 2021 2e-08
1tfx_C58 Complex Of The Second Kunitz Domain Of Tissue Facto 2e-08
1adz_A71 The Solution Structure Of The Second Kunitz Domain 3e-08
2ody_E127 Thrombin-bound Boophilin Displays A Functional And 3e-08
2kcr_A61 Solution Structure Of Anntoxin Length = 61 4e-08
1zr0_B63 Crystal Structure Of Kunitz Domain 1 Of Tissue Fact 2e-07
1kth_A58 The Anisotropic Refinement Of Kunitz Type Domain C5 5e-07
1jc6_A65 Solution Structure Of Bungarus Faciatus Ix, A Kunit 3e-06
1dem_A60 Proteinase Inhibitor Homologues As Potassium Channe 4e-06
1dtx_A59 Crystal Structure Of Alpha-Dendrotoxin From The Gre 8e-06
1yc0_I75 Short Form Hgfa With First Kunitz Domain From Hai-1 3e-05
1bf0_A60 Calcicludine (Cac) From Green Mamba Dendroaspis Ang 4e-05
1dtk_A57 The Nmr Solution Structure Of Dendrotoxin K From Th 6e-05
2jot_A55 Nuclear Magnetic Resonance Studies On Huwentoxin-Xi 8e-05
1irh_A61 The Solution Structure Of The Third Kunitz Domain O 1e-04
3l3t_E57 Human Mesotrypsin Complexed With Amyloid Precursor 2e-04
1aap_A58 X-Ray Crystal Structure Of The Protease Inhibitor D 3e-04
1zjd_B57 Crystal Structure Of The Catalytic Domain Of Coagul 3e-04
1brc_I56 Relocating A Negative Charge In The Binding Pocket 3e-04
3l33_E52 Human Mesotrypsin Complexed With Amyloid Precursor 4e-04
1bik_A147 X-Ray Structure Of Bikunin From The Human Inter-Alp 4e-04
1ca0_D54 Bovine Chymotrypsin Complexed To Appi Length = 54 4e-04
>pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 Back     alignment and structure

Iteration: 1

Score = 56.2 bits (134), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 27/52 (51%), Positives = 32/52 (61%) Query: 23 FHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFC 74 F + AD G + F FY++PD C EF YGGC G+AN F T EECES C Sbjct: 6 FCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTC 57
>pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 Back     alignment and structure
>pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 Back     alignment and structure
>pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 Back     alignment and structure
>pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 Back     alignment and structure
>pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 Back     alignment and structure
>pdb|2KCR|A Chain A, Solution Structure Of Anntoxin Length = 61 Back     alignment and structure
>pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 Back     alignment and structure
>pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 Back     alignment and structure
>pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 Back     alignment and structure
>pdb|1DEM|A Chain A, Proteinase Inhibitor Homologues As Potassium Channel Blockers Length = 60 Back     alignment and structure
>pdb|1DTX|A Chain A, Crystal Structure Of Alpha-Dendrotoxin From The Green Mamba Venom And Its Comparison With The Structure Of Bovine Pancreatic Trypsin Inhibitor Length = 59 Back     alignment and structure
>pdb|1YC0|I Chain I, Short Form Hgfa With First Kunitz Domain From Hai-1 Length = 75 Back     alignment and structure
>pdb|1BF0|A Chain A, Calcicludine (Cac) From Green Mamba Dendroaspis Angusticeps, Nmr, 15 Structures Length = 60 Back     alignment and structure
>pdb|1DTK|A Chain A, The Nmr Solution Structure Of Dendrotoxin K From The Venom Of Dendroaspis Polylepis Polylepis Length = 57 Back     alignment and structure
>pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 Back     alignment and structure
>pdb|1IRH|A Chain A, The Solution Structure Of The Third Kunitz Domain Of Tissue Factor Pathway Inhibitor Length = 61 Back     alignment and structure
>pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 Back     alignment and structure
>pdb|1AAP|A Chain A, X-Ray Crystal Structure Of The Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor Length = 58 Back     alignment and structure
>pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 Back     alignment and structure
>pdb|1BRC|I Chain I, Relocating A Negative Charge In The Binding Pocket Of Trypsin Length = 56 Back     alignment and structure
>pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 Back     alignment and structure
>pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 Back     alignment and structure
>pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} Length = 6 3e-18
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 4e-18
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 7e-18
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 1e-17
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 1e-17
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 1e-17
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 2e-17
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 2e-17
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 2e-17
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 3e-17
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 3e-17
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 3e-17
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 4e-17
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 4e-17
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 4e-17
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 5e-17
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 6e-17
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 6e-17
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 7e-17
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 8e-17
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 2e-16
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 3e-16
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 1e-14
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 2e-15
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 4e-15
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 9e-14
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 Back     alignment and structure
 Score = 72.0 bits (177), Expect = 3e-18
 Identities = 23/51 (45%), Positives = 33/51 (64%)

Query: 28 ADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQE 78
           + G   G+F+ +Y+D  TSSC+ FRY G  G+ NRF T+E+CE+ C   E
Sbjct: 11 RNYGKGSGSFTNYYYDKATSSCKTFRYRGSGGNGNRFKTLEDCEATCVTAE 61


>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 99.97
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 99.97
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 99.85
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 99.84
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 99.84
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 99.84
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 99.84
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 99.84
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 99.84
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 99.84
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 99.83
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 99.83
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 99.83
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} 99.83
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 99.83
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 99.83
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 99.83
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 99.83
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 99.83
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 99.83
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 99.82
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 99.82
1toc_R120 Ornithodorin; vitamin K, zymogen, gamma-carboxyglu 99.82
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 99.81
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 99.77
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 99.7
1toc_R120 Ornithodorin; vitamin K, zymogen, gamma-carboxyglu 99.69
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 99.69
2uuy_B52 Tryptase inhibitor; calcium, zymogen, protease, hy 99.68
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 99.34
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 99.32
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 99.31
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 99.31
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 99.3
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 99.3
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 99.29
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 99.29
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 99.28
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 99.28
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 99.28
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 99.27
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 99.27
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 99.25
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 99.25
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 99.25
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 99.25
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 99.24
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 99.24
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} 99.23
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 99.2
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 99.14
2uuy_B52 Tryptase inhibitor; calcium, zymogen, protease, hy 98.88
2w8x_A72 ION-channel modulator raklp; salivary gland, kunit 92.0
1d0d_A60 TAP, anticoagulant protein; factor XA inhibitor, k 89.03
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Back     alignment and structure
Probab=99.97  E-value=5.9e-32  Score=189.83  Aligned_cols=110  Identities=30%  Similarity=0.558  Sum_probs=97.7

Q ss_pred             CcCCccCCCCCCCCCCCeeeEEEeCCCCCceEeecCCCCCCCCCCCcHHHHHHhccccCC-----------CCCCCCCCC
Q psy10162         20 LAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQEE-----------ILPVGSNST   88 (141)
Q Consensus        20 ~~~~C~~p~~~g~C~~~~~rw~yd~~~~~C~~F~~~gC~gn~N~F~t~~~C~~~C~~~~~-----------~~p~~~~~~   88 (141)
                      .+++|.+|++.|+|.+.++|||||+.+++|+.|.|+||+||.|+|.|+++|+++|.....           .+.++...+
T Consensus         2 ~~~~C~~p~~~G~C~~~~~r~~yn~~t~~C~~F~y~GC~gN~N~F~t~~~C~~~C~~~~~~~~~~~~~~~~~C~~p~~~G   81 (127)
T 2ody_E            2 RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVNDFESADFKTGCEPAADSG   81 (127)
T ss_dssp             CBGGGGSCCCCCSSCCCEEEEEEETTTTEEEEEEECSSCCCSSCBSSHHHHHHHHSSCCCCCCCCCCCHHHHTSSCCCCC
T ss_pred             CCCcccCCCCCccCcCceeeEEEECCCCeeeEeecCCcCCCccccCcHHHHHHhccccccccccccCCcCCcCCCcCCCC
Confidence            468899999999999999999999999999999999999999999999999999998542           233444567


Q ss_pred             CCCCCeeEEEEeCCCCceEEEecceecCCCCCcccc---ccccccCC
Q psy10162         89 EARSGIIIWAMNKASTKFHVILGLLYKNRSGDKTRQ---DYCTKIDL  132 (141)
Q Consensus        89 ~c~~~~~rw~yd~~~~~C~~c~~f~yggc~gn~n~f---~~C~~~~~  132 (141)
                      .|++.++|||||+.+++   |..|+|+||+||.|+|   ++|++.|.
T Consensus        82 ~C~~~~~r~~yd~~~~~---C~~F~Y~GC~GN~N~F~t~~eC~~~C~  125 (127)
T 2ody_E           82 SCAGQLERWFYNVQSGE---CETFVYGGCGGNDNNYESEEECELVCK  125 (127)
T ss_dssp             SSCCCEEEEEEETTTTE---EEEEEECSSCCCSCCBSSHHHHHHHHS
T ss_pred             cccCcceeEEECCCCCc---eeEEEECCcCCCCcCcCCHHHHHHHcc
Confidence            89999999999999999   8999999999999996   56766654



>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Back     alignment and structure
>1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Back     alignment and structure
>2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Back     alignment and structure
>2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A Back     alignment and structure
>2w8x_A ION-channel modulator raklp; salivary gland, kunitz domains, maxik channel activation, sulphur SAD, membrane protein; 1.60A {Rhipicephalus appendiculatus} Back     alignment and structure
>1d0d_A TAP, anticoagulant protein; factor XA inhibitor, kunitz inhibitor, blood clotting inhibitor; 1.62A {Ornithodoros moubata} SCOP: g.8.1.2 PDB: 1kig_I 1tap_A 1tcp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d1zr0b163 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor 7e-17
d1ktha_58 g.8.1.1 (A:) Collagen type VI (domain C5 from alph 3e-16
d1dtxa_59 g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr 3e-16
d1irha_61 g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma 4e-16
d1bika256 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi 4e-16
d1dtka_57 g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp 4e-16
d1aapa_56 g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs 5e-16
d1bf0a_60 g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend 6e-16
d1shpa_55 g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich 9e-16
d1tfxc_58 g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma 9e-16
d1g6xa_58 g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C 9e-16
d1bika154 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit 1e-15
d1jc6a_65 g.8.1.1 (A:) Venom basic protease inhibitor IX (VI 1e-15
d1bunb_61 g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain 2e-15
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure

class: Small proteins
fold: BPTI-like
superfamily: BPTI-like
family: Small Kunitz-type inhibitors & BPTI-like toxins
domain: Tissue factor pathway inhibitor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.6 bits (165), Expect = 7e-17
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 28 ADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCFKQE 78
           D G  +    ++Y+D  T SC++F YGGC G+AN F T E C+  C++ E
Sbjct: 13 LDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIE 63


>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1aapa_56 Alzheimer's amyloid B-protein precursor, APPI {Hum 99.86
d1dtxa_59 alpha-Dendrotoxin {Green mamba (Dendroaspis angust 99.85
d1shpa_55 Trypsin inhibitor {Sea anemone (Stichodactyla heli 99.84
d1ktha_58 Collagen type VI (domain C5 from alpha 3 chain) {H 99.84
d1bika256 Bikunin from inter-alpha-inhibitor complex {Human 99.84
d1dtka_57 Dendrotoxin K {Black mamba (Dendroaspis polylepis 99.83
d1bika154 Bikunin from inter-alpha-inhibitor complex {Human 99.83
d1g6xa_58 Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru 99.83
d1zr0b163 Tissue factor pathway inhibitor {Human (Homo sapie 99.83
d1tfxc_58 Tissue factor pathway inhibitor {Human (Homo sapie 99.83
d1bunb_61 beta2-bungarotoxin, neurotoxin chain {Many-banded 99.83
d1irha_61 Tissue factor pathway inhibitor {Human (Homo sapie 99.82
d1jc6a_65 Venom basic protease inhibitor IX (VIIIb) {Banded 99.81
d1bf0a_60 Calcicludine (cac) {Green mamba (Dendroaspis angus 99.81
d1dtxa_59 alpha-Dendrotoxin {Green mamba (Dendroaspis angust 99.36
d1bunb_61 beta2-bungarotoxin, neurotoxin chain {Many-banded 99.36
d1bika154 Bikunin from inter-alpha-inhibitor complex {Human 99.35
d1bika256 Bikunin from inter-alpha-inhibitor complex {Human 99.34
d1dtka_57 Dendrotoxin K {Black mamba (Dendroaspis polylepis 99.33
d1zr0b163 Tissue factor pathway inhibitor {Human (Homo sapie 99.33
d1aapa_56 Alzheimer's amyloid B-protein precursor, APPI {Hum 99.33
d1ktha_58 Collagen type VI (domain C5 from alpha 3 chain) {H 99.31
d1shpa_55 Trypsin inhibitor {Sea anemone (Stichodactyla heli 99.3
d1bf0a_60 Calcicludine (cac) {Green mamba (Dendroaspis angus 99.27
d1jc6a_65 Venom basic protease inhibitor IX (VIIIb) {Banded 99.26
d1irha_61 Tissue factor pathway inhibitor {Human (Homo sapie 99.25
d1tfxc_58 Tissue factor pathway inhibitor {Human (Homo sapie 99.23
d1g6xa_58 Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru 99.22
d1tocr263 Ornithodorin {Soft tick (Ornithodoros moubata) [Ta 97.06
d1d0da_60 Anticoagulant protein, factor Xa inhibitor {Soft t 89.07
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: BPTI-like
superfamily: BPTI-like
family: Small Kunitz-type inhibitors & BPTI-like toxins
domain: Alzheimer's amyloid B-protein precursor, APPI
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=2.7e-22  Score=120.28  Aligned_cols=56  Identities=34%  Similarity=0.678  Sum_probs=53.9

Q ss_pred             CcCCccCCCCCCCCCCCeeeEEEeCCCCCceEeecCCCCCCCCCCCcHHHHHHhcc
Q psy10162         20 LAGFHLIVADPGHVKGNFSKFYFDPDTSSCQEFRYGGCPGSANRFSTIEECESFCF   75 (141)
Q Consensus        20 ~~~~C~~p~~~g~C~~~~~rw~yd~~~~~C~~F~~~gC~gn~N~F~t~~~C~~~C~   75 (141)
                      ++++|++|++.|+|...++|||||+.+++|+.|.|+||+||.|+|.|+++|++.|.
T Consensus         1 v~d~C~~p~~~G~C~~~~~rwyyd~~~~~C~~F~y~GCgGN~NnF~t~~~C~~~CG   56 (56)
T d1aapa_           1 VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG   56 (56)
T ss_dssp             CGGGGGBCCCCCSSSCCEEEEEEETTTTEEEEEEECSSSCCSCCBSSHHHHHHHHC
T ss_pred             CCcccCCCCCCcCCCCceeEEEEECCCCcEeeeEcCCccCCccCcCCHHHHHHhhC
Confidence            46899999999999999999999999999999999999999999999999999985



>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} Back     information, alignment and structure
>d1d0da_ g.8.1.2 (A:) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata) [TaxId: 6938]} Back     information, alignment and structure