Diaphorina citri psyllid: psy1016


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------72
MGVPAFFRWLSRKYPSVIVHCVEDKPQEVNGQKIPFDSSKPNPNGMEFDNLYLDMNGIIHPCTHPEDKPAPKDEDEMMVAIFECIDRLFRIVRPRKLLYMAIDGVAPRAKMNQQRSRRFRASKETAEKIAEVARIREKLLADGCILPPEKEKGSHFDSNCITPGTPFMARLSACLHYYIHDRLNNDPGWKGIKVILSDANVPGEGEHKIMDYIRKQRAQPDHDPNTQHCLCGADADLIMLGLATHEPNFTIIREEFKPNQARPCDVCGQMGHEMKECVGLDAEPNPESVITFGSEVEFIFVRLSVLREYLEKELAMPNLPFPYSFERALDDWVFMCFFVGNDFLPHLPSLEIREGAVDRLVNLYKKTVYKTQEQLRQEENGGGGGRGVKRSFDDVDESSEEEESNDEVRLWEDGFKDRYYESKFDVPKDDIAFRLMVGHEYVLGLCWVLKYYYQGCRSWKWYFPFHYAPFASDFINIAEVDTNFETGTQPVNNNRILKFILYHFDNKMFFWNKSLINIAEVDTNFETGTQPVNNRILKFYVSDNIHLLILLVLRSWLVSLHVFTITYMIVSTMTLAGKASKLFSRMLTYPGFLTDSGDVKLERVQLIMQDLGMMEDEIFKKRQQTETMFKMRNKMKKRRERQMKMAAQSTKAPSFIPGGQFAPQDSPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEERLHKALAPYYEKLSVEESE
ccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEECccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHcccccCEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccHHHccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHcccHHHHHHcccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccccccccEEEEEcccccHHHHHHHHHHHcccccHHHcc
MGVPAFFRWLSRKYPSVIVHCVEDKPQEVNGQKIPFDSSKPNPNGMEFDNLYLDMNGIIHPCTHPEDKPAPKDEDEMMVAIFECIDRLFRIVRPRKLLYMAIDGVAPRAKMNQQRSRR***********AEVARIREKLLADGCILP******SHFDSNCITPGTPFMARLSACLHYYIHDRLNNDPGWKGIKVILSDANVPGEGEHKIMDYIRKQRAQPDHDPNTQHCLCGADADLIMLGLATHEPNFTIIREEFKPNQARPCDVCGQMGHEMKECVG*********VITFGSEVEFIFVRLSVLREYLEKELAMPNLPFPYSFERALDDWVFMCFFVGNDFLPHLPSLEIREGAVDRLVNLYKKTVYKTQEQLRQEENGGGGGRGVKRSFDDVDESSEEEESNDEVRLWEDGFKDRYYESKFDVPKDDIAFRLMVGHEYVLGLCWVLKYYYQGCRSWKWYFPFHYAPFASDFINIAEVDTNFETGTQPVNNNRILKFILYHFDNKMFFWNKSLINIAEVDTNFETGTQPVNNRILKFYVSDNIHLLILLVLRSWLVSLHVFTITYMIVSTMTLAGKASKLFSRMLTYPGFLTDSGDVKLERVQLIMQDLGMMEDEIFKKRQQTETMFKMRNKMKKR*****************IPGGQFAPQDSPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEERLHKALAPYYEKLS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVPAFFRWLSRKYPSVIVHCVEDKPQEVNGQKIPFDSSKPNPNGMEFDNLYLDMNGIIHPCTHPEDKPAPKDEDEMMVAIFECIDRLFRIVRPRKLLYMAIDGVAPRAKMNQQRSRRFRASKETAEKIAEVARIREKLLADGCILPPEKEKGSHFDSNCITPGTPFMARLSACLHYYIHDRLNNDPGWKGIKVILSDANVPGEGEHKIMDYIRKQRAQPDHDPNTQHCLCGADADLIMLGLATHEPNFTIIREEFKPNQARPCDVCGQMGHEMKECVGLDAEPNPESVITFGSEVEFIFVRLSVLREYLEKELAMPNLPFPYSFERALDDWVFMCFFVGNDFLPHLPSLEIREGAVDRLVNLYKKTVYKTQEQLRQEENGGGGGRGVKRSFDDVDESSEEEESNDEVRLWEDGFKDRYYESKFDVPKDDIAFRLMVGHEYVLGLCWVLKYYYQGCRSWKWYFPFHYAPFASDFINIAEVDTNFETGTQPVNNNRILKFILYHFDNKMFFWNKSLINIAEVDTNFETGTQPVNNRILKFYVSDNIHLLILLVLRSWLVSLHVFTITYMIVSTMTLAGKASKLFSRMLTYPGFLTDSGDVKLERVQLIMQDLGMMEDEIFKKRQQTETMFKMRNKMKKRRERQMKMAAQSTKAPSFIPGGQFAPQDSPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEERLHKALAPYYEKLSVEESE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
5'-3' exoribonuclease 2 Possesses 5'->3' exoribonuclease activity. May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.confidentQ5R4L5
5'-3' exoribonuclease 2 Possesses 5'->3' exoribonuclease activity (By similarity). May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.confidentQ9H0D6
5'-3' exoribonuclease 2 homolog Possesses 5'->3' exoribonuclease activity. May promote the termination of transcription by RNA polymerase II.confidentQ9VM71

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016235 [CC]aggresomeprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0016234, GO:0044424
GO:0000738 [BP]DNA catabolic process, exonucleolyticprobableGO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007283 [BP]spermatogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0004534 [MF]5'-3' exoribonuclease activityprobableGO:0016787, GO:0016796, GO:0004518, GO:0004527, GO:0004540, GO:0004532, GO:0016788, GO:0003824, GO:0008409, GO:0016896, GO:0003674
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034660 [BP]ncRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0006397 [BP]mRNA processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0003676 [MF]nucleic acid bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0005488
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006353 [BP]DNA-dependent transcription, terminationprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699
GO:0006401 [BP]RNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0007017 [BP]microtubule-based processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FQD, chain A
Confidence level:very confident
Coverage over the Query: 2-257,274-285,296-381
View the alignment between query and template
View the model in PyMOL