Diaphorina citri psyllid: psy10185


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------
SNIACPVVWINIGDSVHYSPPRSPILHALLSGSISGTVSTILLQPLDVIKTRLQSNHSKAFHYDSLRQALVHIFRTEGLKGLWSGTVATLVRDAPYSGLHFMFYTQAKSFKPTGLNETTPGYVLFQLACGGAAGATATLVTQPADIIKTRIQLTCQSPATSSLKYADYGVLGFVQGFVPRMLKRTLMSAISWTIFE
ccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHEEcHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccHHHHHHHccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccHHHHHHHccccHHccccHHHHHHHHHHHHEEEEEcc
**IACPVVWINIGDSVHYSPPRSPILHALLSGSISGTVSTILLQPLDVIKTRLQSNHSKAFHYDSLRQALVHIFRTEGLKGLWSGTVATLVRDAPYSGLHFMFYTQAKSFKPTGLNETTPGYVLFQLACGGAAGATATLVTQPADIIKTRIQLTCQSPATSSLKYADYGVLGFVQGFVPRMLKRTLMSAISWTIFE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SNIACPVVWINIGDSVHYSPPRSPILHALLSGSISGTVSTILLQPLDVIKTRLQSNHSKAFHYDSLRQALVHIFRTEGLKGLWSGTVATLVRDAPYSGLHFMFYTQAKSFKPTGLNETTPGYVLFQLACGGAAGATATLVTQPADIIKTRIQLTCQSPATSSLKYADYGVLGFVQGFVPRMLKRTLMSAISWTIFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Solute carrier family 25 member 38-B Mitochondrial carrier required during erythropoiesis. Probably involved in the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.confidentP0CAT2
Solute carrier family 25 member 38 homolog Mitochondrial carrier required for the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.confidentQ6CNY8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016020 [CC]membraneprobableGO:0005575
GO:0022891 [MF]substrate-specific transmembrane transporter activityprobableGO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 22-196
View the alignment between query and template
View the model in PyMOL