Diaphorina citri psyllid: psy10196

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----

MDIGLILMSQLSQRASIAENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATFGPEAESTSQHFLFLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQEDRDVEVSLDVRMWSPEMKKNENEVKVQPSPPVLTPFSPLDETESSRPPTLVAHKRHCVGPTNTGGGFYKRRTVHDDLDSEDSDQQEPPQLSPESQAAATTCRKRGRPPKKHPPEPPIQEPPVKKPTKPNFVSIVLANKNKQLKSLFDEDSSDYKPNKIRALKF

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEECcccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccEEEEEEEcccHHHHHHcccccccccccccccccc

*DIG************************************************************************TFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATF************FLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQ****VEVSL************************************************CVG******GFY********************************************************PTKPNFVSIVLANKNKQLKSLFD**SSDYKPNKIRALKF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DMS, chain A
Confidence level:very confident
Coverage over the Query: 68-127
View the alignment between query and template
View the model in PyMOL

Template: 1B72, chain A
Confidence level:confident
Coverage over the Query: 26-34,74-131
View the alignment between query and template
View the model in PyMOL