Psyllid ID: psy10196

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MDIGLILMSQLSQRASIAENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATFGPEAESTSQHFLFLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQEDRDVEVSLDVRMWSPEMKKNENEVKVQPSPPVLTPFSPLDETESSRPPTLVAHKRHCVGPTNTGGGFYKRRTVHDDLDSEDSDQQEPPQLSPESQAAATTCRKRGRPPKKHPPEPPIQEPPVKKPTKPNFVSIVLANKNKQLKSLFDEDSSDYKPNKIRALKF
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccEEEEEcccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccEEEEEEEcccHHHHHHcccccccccccccccccc
ccccccccccHcHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHcccHHHHHHccccccccccccEEEEcc
MDIGLILMSQLSQRASiaensgnsssdeQAVSDlrrkpsdtvdsdleidddkcsrggslspslspvdkkkhrrnrttftTYQLHELERAFekshypdvysreelamkvnlpEVRVQFTALAAALRVGVAIatfgpeaestSQHFLFLLSSRildrflpppgvepgsldcqasvftapAELVDILRVtggqedrdveVSLDvrmwspemkknenevkvqpsppvltpfspldetessrpptlvahkrhcvgptntgggfykrrtvhddldsedsdqqeppqlspesqAAATTcrkrgrppkkhppeppiqeppvkkptkpnFVSIVLANKNKQLKslfdedssdykpnkiralkf
MDIGLILMSQLSQRASIaensgnsssdeqavsdlrrkpsdtvdsdleidddkcsrggslspslspvdkkkhrrnrttfttyqlheleraFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATFGPEAESTSQHFLFLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILrvtggqedrdvevsldvrmwspemkknenevkvqpsppvLTPFSPLDETESSrpptlvahkrhcvgptntgggfyKRRTVHDDLDSEDSdqqeppqlspesqaAATTCRKrgrppkkhppeppiqeppvkkptkPNFVSIVLANKNKQLkslfdedssdykpnkiralkf
MDIGLILMSQLSQRASIAENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRggslspslspVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATFGPEAESTSQHFLFLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQEDRDVEVSLDVRMWSPEMKKNENEVKVQPSPPVLTPFSPLDETESSRPPTLVAHKRHCVGPTNTGGGFYKRRTVHddldsedsdqqeppqlspesqAAATTCRKRGRppkkhppeppiqeppvkkpTKPNFVSIVLANKNKQLKSLFDEDSSDYKPNKIRALKF
****************************************************************************TFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATFGPEAESTSQHFLFLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQ****VEVSL************************************************CVG******GFY***************************************************************SIVL****************************
*DIG************************************************************************TFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAAL***********************************************************************************************************************************************************************************************PTKPNFVSIVLANKNKQLKSLFD**SSDYKPNKIRALKF
MDIGLILMSQLS*********************************LEIDDDKCS*******************NRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATFGPEAESTSQHFLFLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQEDRDVEVSLDVRMWSPEMKK*********SPPVLTPFSP**********TLVAHKRHCVGPTNTGGGFYKRRTVH*******************************************QEPPVKKPTKPNFVSIVLANKNKQLKSLFDEDSSDYKPNKIRALKF
****LILMSQLSQRASI*********************************************************RTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATF************FLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQEDRDVEVSLDVRMWSPEMKKNENEVKVQPSPPVLTPFSPLDETESSRPPTLVAHKRHCVGPTNTGGGFYKRRTVHDDLDSEDSDQQEPPQLS***QAAATTCRKRGRPPKKHPPEPPIQEPPVKKPTKPNFVSIVLANKNKQLKSLFDEDSSDYKPNKIRALKF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIGLILMSQLSQRASIAENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATFGPEAESTSQHFLFLLSSRILDRFLPPPGVEPGSLDCQASVFTAPAELVDILRVTGGQEDRDVEVSLDVRMWSPEMKKNENEVKVQPSPPVLTPFSPLDETESSRPPTLVAHKRHCVGPTNTGGGFYKRRTVHDDLDSEDSDQQEPPQLSPESQAAATTCRKRGRPPKKHPPEPPIQEPPVKKPTKPNFVSIVLANKNKQLKSLFDEDSSDYKPNKIRALKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query354 2.2.26 [Sep-21-2011]
Q9W2Q1873 Retinal homeobox protein yes N/A 0.251 0.101 0.598 3e-24
Q9PVX0317 Retinal homeobox protein yes N/A 0.172 0.192 0.868 3e-23
O42567325 Retinal homeobox protein N/A N/A 0.138 0.150 1.0 3e-22
O42356330 Retinal homeobox protein yes N/A 0.138 0.148 1.0 3e-22
Q9I9D5334 Retinal homeobox protein N/A N/A 0.138 0.146 1.0 3e-22
O42201322 Retinal homeobox protein N/A N/A 0.138 0.152 1.0 3e-22
Q9PVY0228 Retinal homeobox protein no N/A 0.138 0.214 1.0 3e-22
O42357327 Retinal homeobox protein no N/A 0.138 0.149 1.0 4e-22
O42358292 Retinal homeobox protein no N/A 0.166 0.202 0.852 4e-22
O97039268 Retinal homeobox protein N/A N/A 0.293 0.388 0.504 5e-22
>sp|Q9W2Q1|RX_DROME Retinal homeobox protein Rx OS=Drosophila melanogaster GN=Rx PE=2 SV=2 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 65/102 (63%), Gaps = 13/102 (12%)

Query: 16  SIAENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNR 75
           S+   S  SS D    +   +    T  SD E  DD C+             KKKHRRNR
Sbjct: 486 SLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCA-------------KKKHRRNR 532

Query: 76  TTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQF 117
           TTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 
Sbjct: 533 TTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQV 574
Appears to function in brain development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 OS=Gallus gallus GN=RX2 PE=2 SV=1 Back     alignment and function description
>sp|O42567|RXB_XENLA Retinal homeobox protein Rx-B OS=Xenopus laevis GN=rax-b PE=2 SV=2 Back     alignment and function description
>sp|O42356|RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio GN=rx1 PE=2 SV=2 Back     alignment and function description
>sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax fasciatus GN=rx1 PE=2 SV=1 Back     alignment and function description
>sp|O42201|RXA_XENLA Retinal homeobox protein Rx-A OS=Xenopus laevis GN=rax-a PE=2 SV=2 Back     alignment and function description
>sp|Q9PVY0|RX1_CHICK Retinal homeobox protein Rx1 OS=Gallus gallus GN=RX1 PE=2 SV=1 Back     alignment and function description
>sp|O42357|RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio GN=rx2 PE=2 SV=1 Back     alignment and function description
>sp|O42358|RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio GN=rx3 PE=2 SV=1 Back     alignment and function description
>sp|O97039|RX_DUGJA Retinal homeobox protein Rax (Fragment) OS=Dugesia japonica GN=RAX PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
194753694 925 GF12207 [Drosophila ananassae] gi|190620 0.251 0.096 0.598 1e-22
195456001 937 GK23335 [Drosophila willistoni] gi|19417 0.248 0.093 0.603 2e-22
195346236 895 GM15784 [Drosophila sechellia] gi|194135 0.248 0.098 0.603 2e-22
2950355 902 homebox protein DRx [Drosophila melanoga 0.251 0.098 0.598 2e-22
28573580 873 retinal homeobox [Drosophila melanogaste 0.251 0.101 0.598 2e-22
198458256 921 GA10035 [Drosophila pseudoobscura pseudo 0.248 0.095 0.603 2e-22
195153960 920 GL17060 [Drosophila persimilis] gi|19411 0.248 0.095 0.603 2e-22
195585235 903 GD11547 [Drosophila simulans] gi|1941944 0.251 0.098 0.598 3e-22
242006784128 retinal homeobox protein, putative [Pedi 0.313 0.867 0.489 3e-22
312384105 671 hypothetical protein AND_02561 [Anophele 0.169 0.089 0.767 3e-22
>gi|194753694|ref|XP_001959145.1| GF12207 [Drosophila ananassae] gi|190620443|gb|EDV35967.1| GF12207 [Drosophila ananassae] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/102 (59%), Positives = 65/102 (63%), Gaps = 13/102 (12%)

Query: 16  SIAENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNR 75
           S+   S  SS D    +   +    T  SD E  DD C+             KKKHRRNR
Sbjct: 518 SLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCA-------------KKKHRRNR 564

Query: 76  TTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQF 117
           TTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 
Sbjct: 565 TTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQL 606

Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195456001|ref|XP_002074959.1| GK23335 [Drosophila willistoni] gi|194171044|gb|EDW85945.1| GK23335 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195346236|ref|XP_002039672.1| GM15784 [Drosophila sechellia] gi|194135021|gb|EDW56537.1| GM15784 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|2950355|emb|CAA11241.1| homebox protein DRx [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28573580|ref|NP_726006.2| retinal homeobox [Drosophila melanogaster] gi|17380504|sp|Q9W2Q1.2|RX_DROME RecName: Full=Retinal homeobox protein Rx; Short=DRx; Short=DRx1 gi|21392130|gb|AAM48419.1| RE39020p [Drosophila melanogaster] gi|28380638|gb|AAF46639.3| retinal homeobox [Drosophila melanogaster] gi|220960168|gb|ACL92620.1| Rx-PA [synthetic construct] Back     alignment and taxonomy information
>gi|198458256|ref|XP_001360971.2| GA10035 [Drosophila pseudoobscura pseudoobscura] gi|198136277|gb|EAL25547.2| GA10035 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195153960|ref|XP_002017891.1| GL17060 [Drosophila persimilis] gi|194113687|gb|EDW35730.1| GL17060 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195585235|ref|XP_002082395.1| GD11547 [Drosophila simulans] gi|194194404|gb|EDX07980.1| GD11547 [Drosophila simulans] Back     alignment and taxonomy information
>gi|242006784|ref|XP_002424225.1| retinal homeobox protein, putative [Pediculus humanus corporis] gi|212507587|gb|EEB11487.1| retinal homeobox protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|312384105|gb|EFR28914.1| hypothetical protein AND_02561 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
ZFIN|ZDB-GENE-990415-237327 rx2 "retinal homeobox gene 2" 0.282 0.305 0.562 1.6e-22
UNIPROTKB|F1NH36262 Gga.55791 "Uncharacterized pro 0.138 0.187 1.0 4.3e-22
UNIPROTKB|Q9PVX0317 RX2 "Retinal homeobox protein 0.138 0.154 1.0 4.3e-22
UNIPROTKB|Q9PVY0228 RX1 "Retinal homeobox protein 0.138 0.214 1.0 4.3e-22
ZFIN|ZDB-GENE-990415-236330 rx1 "retinal homeobox gene 1" 0.138 0.148 1.0 4.3e-22
FB|FBgn0020617873 Rx "Retinal Homeobox" [Drosoph 0.248 0.100 0.603 1.2e-21
ZFIN|ZDB-GENE-990415-238292 rx3 "retinal homeobox gene 3" 0.138 0.167 0.959 2.4e-21
UNIPROTKB|E1BHB8351 LOC615339 "Uncharacterized pro 0.138 0.139 0.979 3e-21
UNIPROTKB|E2QW59331 RAX "Uncharacterized protein" 0.138 0.148 0.979 3e-21
UNIPROTKB|Q9Y2V3346 RAX "Retinal homeobox protein 0.138 0.141 0.979 3e-21
ZFIN|ZDB-GENE-990415-237 rx2 "retinal homeobox gene 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 1.6e-22, P = 1.6e-22
 Identities = 63/112 (56%), Positives = 72/112 (64%)

Query:     5 LILMSQLSQRASIAENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRXXXXXXXXX 64
             L +  Q  Q+ S+  ++G  S+D+   +DL   P   V+SD    D              
Sbjct:    81 LQIPDQTQQQQSVYHDTGLFSTDK-CDADLG-DPRSNVESDSRSPD----------IPDE 128

Query:    65 XVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 116
                KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ
Sbjct:   129 DQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 180
GO:0003677 "DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0060219 "camera-type eye photoreceptor cell differentiation" evidence=IGI
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
UNIPROTKB|F1NH36 Gga.55791 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PVX0 RX2 "Retinal homeobox protein Rx2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PVY0 RX1 "Retinal homeobox protein Rx1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-236 rx1 "retinal homeobox gene 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0020617 Rx "Retinal Homeobox" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-238 rx3 "retinal homeobox gene 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHB8 LOC615339 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QW59 RAX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2V3 RAX "Retinal homeobox protein Rx" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
pfam0004657 pfam00046, Homeobox, Homeobox domain 8e-17
smart0038957 smart00389, HOX, Homeodomain 4e-13
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-13
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-04
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 73.3 bits (181), Expect = 8e-17
 Identities = 26/45 (57%), Positives = 31/45 (68%)

Query: 72  RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 116
           RR RTTFT  QL ELE+ FEK+ YP    REELA K+ L E +V+
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVK 45

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 354
KOG0488|consensus309 99.76
KOG0489|consensus261 99.75
KOG0494|consensus332 99.75
KOG0842|consensus307 99.73
KOG0484|consensus125 99.72
KOG0487|consensus308 99.69
KOG0850|consensus245 99.68
KOG0844|consensus408 99.67
KOG0485|consensus268 99.66
KOG0843|consensus197 99.66
KOG2251|consensus228 99.63
KOG0492|consensus246 99.57
KOG0493|consensus342 99.57
KOG0848|consensus317 99.53
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.53
KOG0491|consensus194 99.51
KOG0486|consensus351 99.5
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.49
KOG3802|consensus398 99.43
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.39
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.36
KOG0483|consensus198 99.32
KOG4577|consensus383 99.31
COG5576156 Homeodomain-containing transcription factor [Trans 99.31
KOG0490|consensus235 99.28
KOG0847|consensus288 99.22
KOG0849|consensus354 99.07
KOG0490|consensus235 98.64
KOG1168|consensus385 98.47
KOG0774|consensus334 98.23
KOG0775|consensus304 98.15
KOG1146|consensus 1406 97.78
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.76
KOG2252|consensus558 97.69
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 94.46
KOG0773|consensus342 94.26
KOG3623|consensus 1007 89.49
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 88.11
>KOG0488|consensus Back     alignment and domain information 
Probab=99.76  E-value=1.1e-18  Score=170.52  Aligned_cols=67  Identities=34%  Similarity=0.393  Sum_probs=63.8

Q ss_pred             ccCCCCCCCCccCHHHHHHHHHHHHhcCCCCHHHHHHHHHHcCCCCcccccccchhhhccccccccC
Q psy10196         67 DKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIATF  133 (354)
Q Consensus        67 ~~kK~RR~RT~fT~~Ql~~LE~~F~~~~yPs~~~R~~LA~~LgLse~qVqVWFQNRRaK~Kk~~~~~  133 (354)
                      ..||+|+.||.||..||.+||+.|++++|++..+|++||+.|||+..|||+||||||+|||++....
T Consensus       168 ~pkK~RksRTaFT~~Ql~~LEkrF~~QKYLS~~DR~~LA~~LgLTdaQVKtWfQNRRtKWKrq~a~g  234 (309)
T KOG0488|consen  168 TPKKRRKSRTAFSDHQLFELEKRFEKQKYLSVADRIELAASLGLTDAQVKTWFQNRRTKWKRQTAEG  234 (309)
T ss_pred             CCcccccchhhhhHHHHHHHHHHHHHhhcccHHHHHHHHHHcCCchhhHHHHHhhhhHHHHHHHHhh
Confidence            4588899999999999999999999999999999999999999999999999999999999998763

>KOG0489|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 6e-15
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-14
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 3e-13
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-12
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 8e-12
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 5e-11
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 1e-10
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 4e-10
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-08
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 2e-07
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 3e-06
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%)
Query: 67  DKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 116
           +K K RRNRTTFT+YQL ELE+ F+K+HYPDVY+RE+LAM+ +L E RVQ
Sbjct: 5   NKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQ 54
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-28
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 5e-28
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 6e-28
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-27
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 4e-27
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-26
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-25
3a02_A60 Homeobox protein aristaless; homeodomain, developm 5e-25
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-24
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-22
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-21
1uhs_A72 HOP, homeodomain only protein; structural genomics 4e-19
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-18
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-17
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-16
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-14
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-14
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-13
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-13
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 8e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-11
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-10
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 7e-10
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 3e-09
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-09
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-09
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 7e-09
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-08
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-08
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-08
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-08
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-08
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 6e-08
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 2e-07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-07
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-07
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 7e-07
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 8e-07
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-06
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 3e-06
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 3e-06
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 6e-06
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-05
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-05
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 4e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 5e-05
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  104 bits (262), Expect = 2e-28
 Identities = 31/50 (62%), Positives = 40/50 (80%)

Query: 67  DKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 116
            K+K RR+RTTF+  QL ELERAFE++ YPD+Y+REELA + NL E R+Q
Sbjct: 14  LKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 63
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.79
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.78
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.77
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.77
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.77
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.76
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.76
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.76
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.76
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.75
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.75
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.74
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.74
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.74
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.74
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.74
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.74
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.74
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.73
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.73
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.73
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.73
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.73
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.73
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.72
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.72
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.72
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.71
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.71
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.71
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.71
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.71
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.71
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.71
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.7
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.7
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.7
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.69
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.69
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.69
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.69
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.69
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.68
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.68
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.68
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.68
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.68
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.66
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.65
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.65
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.65
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.65
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.64
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.64
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.64
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.63
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.63
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.63
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.63
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.62
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.62
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.61
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.61
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.6
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.6
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.6
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.6
2e19_A64 Transcription factor 8; homeobox domain, structura 99.59
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.59
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.57
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.46
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.44
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.32
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.26
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.26
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.16
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.49
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 89.66
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=9.1e-20  Score=143.31  Aligned_cols=66  Identities=32%  Similarity=0.393  Sum_probs=61.7

Q ss_pred             ccCCCCCCCCccCHHHHHHHHHHHHhcCCCCHHHHHHHHHHcCCCCcccccccchhhhcccccccc
Q psy10196         67 DKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGVAIAT  132 (354)
Q Consensus        67 ~~kK~RR~RT~fT~~Ql~~LE~~F~~~~yPs~~~R~~LA~~LgLse~qVqVWFQNRRaK~Kk~~~~  132 (354)
                      ..++.||.||.||..|+.+||..|+.++||+..+|++||..|||++.||+|||||||+|+|+....
T Consensus        13 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk~~~s   78 (80)
T 2dmt_A           13 KAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGPS   78 (80)
T ss_dssp             CCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSCCCSC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhcccCC
Confidence            356778899999999999999999999999999999999999999999999999999999987653
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 354
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-16
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-15
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-14
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-13
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 1e-13
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-13
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-13
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 7e-13
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-12
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-12
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-12
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-12
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-12
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 7e-12
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-11
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 7e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 9e-11
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 4e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 5e-09
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 9e-09
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 7e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 9e-08
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-07
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-07
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 7e-07
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-04
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 8e-04
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 71.0 bits (174), Expect = 2e-16
 Identities = 17/57 (29%), Positives = 31/57 (54%)

Query: 60  SPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 116
           +P+ + +  +  R+ R  +T +Q  ELE+ F  + Y     R E+A  +NL E +V+
Sbjct: 2   NPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVK 58
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.79
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.77
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.77
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.77
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.77
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.77
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.76
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.76
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.76
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.75
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.73
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.72
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.72
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.72
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.72
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.71
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.7
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.69
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.68
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.68
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.67
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.66
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.65
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.62
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.59
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.56
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.51
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.51
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.44
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.41
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.37
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.9e-20  Score=138.56  Aligned_cols=57  Identities=19%  Similarity=0.324  Sum_probs=55.1

Q ss_pred             CCCCCccCHHHHHHHHHHHHhcCCCCHHHHHHHHHHcCCCCcccccccchhhhcccc
Q psy10196         72 RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQFTALAAALRVGV  128 (354)
Q Consensus        72 RR~RT~fT~~Ql~~LE~~F~~~~yPs~~~R~~LA~~LgLse~qVqVWFQNRRaK~Kk  128 (354)
                      ||.||.||.+|+.+||..|..++||+..+|++||..|||++.||+|||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            677899999999999999999999999999999999999999999999999999885
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure