Diaphorina citri psyllid: psy10208


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MSYVNTTRSIIETVKYIEKELRSMDGLFIFGTPATSVIALGSDVFHIYRLSSGLNKRGWNTNSLQFPVGIHICITHMHTQPGVADKFISDVREELAIIMQNPGLQLEGVMAMYGKSHSIPDRSIIGDFTRYYIDATYYTPDSK
ccHHHHHHHHHHHHHHHHHHHHHcccCEEEccccEEEEEEEcccccHHHHHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccccccHHHHHHHHHHHHHccccccc
MSYVNTTRSIIETVKYIEKELRSMDGLFIFGTPATSVIALGSDVFHIYRLSSGLNKRGWNTNSLQFPVGIHICITHMHTQPGVADKFISDVREELAIIMQNPGLQLEGVMAMYGKSHSIPDRSIIGDFTRYYIDATYYT****
xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYVNTTRSIIETVKYIEKELRSMDGLFIFGTPATSVIALGSDVFHIYRLSSGLNKRGWNTNSLQFPVGIHICITHMHTQPGVADKFISDVREELAIIMQNPGLQLEGVMAMYGKSHSIPDRSIIGDFTRYYIDATYYTPDSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sphingosine-1-phosphate lyase Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Sphingolipid catabolism is required for normal development including viability, reproduction and muscle development.confidentQ9V7Y2

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MC6, chain A
Confidence level:very confident
Coverage over the Query: 1-101,123-138
View the alignment between query and template
View the model in PyMOL