Diaphorina citri psyllid: psy10225


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MNQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS
cccccEEcccccccccEEEEEEcccccccccccccccccccccccEEEEEEcccccccEEEEcccccccccCEECccccHHHHHHHHHHccccccccccccccccccccEEEEEEHHHHcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccEEEEEEcccccc
***FYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKR*********RTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Disks large homolog 2 Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses.confidentQ63622

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0032281 [CC]alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0008328, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0019903 [MF]protein phosphatase bindingprobableGO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044309 [CC]neuron spineprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0010923 [BP]negative regulation of phosphatase activityprobableGO:0051336, GO:0019220, GO:0051346, GO:0019222, GO:0065009, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048666 [BP]neuron developmentprobableGO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TVT, chain A
Confidence level:very confident
Coverage over the Query: 17-87,110-192
View the alignment between query and template
View the model in PyMOL