Psyllid ID: psy10225


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MNQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS
cccccEEcccccccccEEEEEEcccccccccccccccccccccccEEEEEEcccccccEEEEcccccccccEEEEccccHHHHHHHHHHccccccccccccccccccccEEEEEEHHHHcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccEEEEEEcccccc
cccEEEEEEEHHccccEEEEEEEEcccccccccccccccccccccEEEEEEcccHHHHHHHHcccccccccccEcccHHHHHHHHHHHccccccccccccccccccccEEEEEEccccEEEcHHHHHcccccccccccccccHHHccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEHHcccc
MNQFYIVNVILISTHLFSFsralfdydptkddglpsrglpfhygdilhvtnasddEWWQARrvlpsgdeqgigivpskkRWERKQRARDRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLtrglkagqmtsnfkehkyldldvpigtiRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS
MNQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRvlpsgdeqgigivpskkrwerkqrardrtvkfqghvpvllekvsiTQFSMIELNTIFKLIEKSVALGLTRGLKAgqmtsnfkehkyldldvpiGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS
MNQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS
***FYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIV*************DRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVIN******
*****************SFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKR****************************************LIEKSV*********************YLDLDVPIGTI**********IQMFLYSVTVISIAICLKNKHNELQEHHILVINKS****
MNQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKK**********RTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS
*NQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQFYIVNVILISTHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVKFQGHVPVLLEKVSITQFSMIELNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTIRRFQYGLKKIIQMFLYSVTVISIAICLKNKHNELQEHHILVINKSLRQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
P31007 970 Disks large 1 tumor suppr yes N/A 0.396 0.084 0.768 2e-35
Q5PYH7 881 Disks large homolog 2 OS= no N/A 0.439 0.103 0.615 2e-27
Q15700 870 Disks large homolog 2 OS= no N/A 0.425 0.101 0.625 5e-27
Q63622 852 Disks large homolog 2 OS= yes N/A 0.429 0.104 0.617 7e-27
Q91XM9 852 Disks large homolog 2 OS= no N/A 0.429 0.104 0.617 1e-26
Q12959 904 Disks large homolog 1 OS= no N/A 0.391 0.089 0.609 2e-26
Q811D0 905 Disks large homolog 1 OS= no N/A 0.367 0.083 0.671 2e-26
Q62696 911 Disks large homolog 1 OS= no N/A 0.367 0.083 0.671 3e-26
Q28C55 927 Disks large homolog 1 OS= no N/A 0.367 0.081 0.671 7e-26
Q62936 849 Disks large homolog 3 OS= no N/A 0.367 0.089 0.684 4e-25
>sp|P31007|DLG1_DROME Disks large 1 tumor suppressor protein OS=Drosophila melanogaster GN=dlg1 PE=1 SV=2 Back     alignment and function desciption
 Score =  148 bits (374), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 63/82 (76%), Positives = 71/82 (86%)

Query: 19  FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
           + RALFDYDP +DDGLPSRGLPF +GDILHVTNASDDEWWQARRVL   +++ IGIVPSK
Sbjct: 624 YVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSK 683

Query: 79  KRWERKQRARDRTVKFQGHVPV 100
           +RWERK RARDR+VKFQGH   
Sbjct: 684 RRWERKMRARDRSVKFQGHAAA 705




During embryonic development, some isoforms are essential for proper neuronal differentiation and organization. Required for cell polarity; maintenance of apicobasal polarity. Plays a critical role at septate junctions in cellular growth control during larval development. The presence of a guanylate kinase domain suggests involvement in cellular adhesion as well as signal transduction to control cellular proliferation.
Drosophila melanogaster (taxid: 7227)
>sp|Q5PYH7|DLG2_DANRE Disks large homolog 2 OS=Danio rerio GN=dlg2 PE=2 SV=1 Back     alignment and function description
>sp|Q15700|DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens GN=DLG2 PE=1 SV=3 Back     alignment and function description
>sp|Q63622|DLG2_RAT Disks large homolog 2 OS=Rattus norvegicus GN=Dlg2 PE=1 SV=1 Back     alignment and function description
>sp|Q91XM9|DLG2_MOUSE Disks large homolog 2 OS=Mus musculus GN=Dlg2 PE=1 SV=2 Back     alignment and function description
>sp|Q12959|DLG1_HUMAN Disks large homolog 1 OS=Homo sapiens GN=DLG1 PE=1 SV=2 Back     alignment and function description
>sp|Q811D0|DLG1_MOUSE Disks large homolog 1 OS=Mus musculus GN=Dlg1 PE=1 SV=1 Back     alignment and function description
>sp|Q62696|DLG1_RAT Disks large homolog 1 OS=Rattus norvegicus GN=Dlg1 PE=1 SV=1 Back     alignment and function description
>sp|Q28C55|DLG1_XENTR Disks large homolog 1 OS=Xenopus tropicalis GN=dlg1 PE=2 SV=1 Back     alignment and function description
>sp|Q62936|DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus GN=Dlg3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
242023647 473 Discs large 1 tumor suppressor protein, 0.425 0.186 0.840 4e-41
189234387 729 PREDICTED: similar to discs large 1 CG17 0.425 0.120 0.829 7e-40
270001944 512 hypothetical protein TcasGA2_TC000855 [T 0.425 0.171 0.829 9e-40
333033759 882 discs large 1 [Gryllus bimaculatus] 0.512 0.120 0.722 2e-39
307175597 593 Disks large 1 tumor suppressor protein [ 0.425 0.148 0.795 8e-39
322787023 500 hypothetical protein SINV_09500 [Solenop 0.420 0.174 0.793 1e-38
383849085 946 PREDICTED: disks large 1 tumor suppresso 0.425 0.093 0.784 1e-38
340722459 754 PREDICTED: disks large 1 tumor suppresso 0.425 0.116 0.784 1e-38
380029430 636 PREDICTED: disks large 1 tumor suppresso 0.425 0.138 0.784 3e-38
328713189 847 PREDICTED: disks large homolog 1-like is 0.454 0.110 0.712 5e-36
>gi|242023647|ref|XP_002432243.1| Discs large 1 tumor suppressor protein, putative [Pediculus humanus corporis] gi|212517645|gb|EEB19505.1| Discs large 1 tumor suppressor protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 83/88 (94%)

Query: 19  FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
           + RALFDYDP KDDGLPSRGLPFHYGDILHVTNASDDEWWQAR+VLP+G+E+G+GIVPSK
Sbjct: 116 YVRALFDYDPNKDDGLPSRGLPFHYGDILHVTNASDDEWWQARKVLPTGEEEGMGIVPSK 175

Query: 79  KRWERKQRARDRTVKFQGHVPVLLEKVS 106
           +RWERKQRARDRTVKFQGHVP  ++K S
Sbjct: 176 RRWERKQRARDRTVKFQGHVPQNMDKQS 203




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189234387|ref|XP_001815997.1| PREDICTED: similar to discs large 1 CG1725-PK [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270001944|gb|EEZ98391.1| hypothetical protein TcasGA2_TC000855 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|333033759|dbj|BAK23256.1| discs large 1 [Gryllus bimaculatus] Back     alignment and taxonomy information
>gi|307175597|gb|EFN65507.1| Disks large 1 tumor suppressor protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322787023|gb|EFZ13247.1| hypothetical protein SINV_09500 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383849085|ref|XP_003700177.1| PREDICTED: disks large 1 tumor suppressor protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340722459|ref|XP_003399623.1| PREDICTED: disks large 1 tumor suppressor protein-like [Bombus terrestris] gi|350416652|ref|XP_003491037.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 1 [Bombus impatiens] gi|350416654|ref|XP_003491038.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380029430|ref|XP_003698376.1| PREDICTED: disks large 1 tumor suppressor protein-like [Apis florea] Back     alignment and taxonomy information
>gi|328713189|ref|XP_001948578.2| PREDICTED: disks large homolog 1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
FB|FBgn0001624 970 dlg1 "discs large 1" [Drosophi 0.381 0.081 0.797 2e-31
UNIPROTKB|F1MNQ1 361 DLG2 "Uncharacterized protein" 0.425 0.243 0.625 6.6e-28
ZFIN|ZDB-GENE-050221-3 881 dlg2 "discs, large (Drosophila 0.439 0.103 0.615 3e-26
UNIPROTKB|F1M907 767 Dlg2 "Disks large homolog 2" [ 0.425 0.114 0.625 3.7e-26
UNIPROTKB|F8W750221 DLG2 "Disks large homolog 2" [ 0.425 0.398 0.625 5.2e-26
RGD|619895 852 Dlg2 "discs, large homolog 2 ( 0.429 0.104 0.617 5.6e-26
UNIPROTKB|Q15700 870 DLG2 "Disks large homolog 2" [ 0.425 0.101 0.625 6e-26
MGI|MGI:1344351 852 Dlg2 "discs, large homolog 2 ( 0.429 0.104 0.617 1.2e-25
UNIPROTKB|F1NPX2 711 DLG2 "Uncharacterized protein" 0.367 0.106 0.684 1.2e-25
MGI|MGI:107231 905 Dlg1 "discs, large homolog 1 ( 0.367 0.083 0.671 2.4e-25
FB|FBgn0001624 dlg1 "discs large 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 356 (130.4 bits), Expect = 2.0e-31, P = 2.0e-31
 Identities = 63/79 (79%), Positives = 71/79 (89%)

Query:    19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
             + RALFDYDP +DDGLPSRGLPF +GDILHVTNASDDEWWQARRVL   +++ IGIVPSK
Sbjct:   624 YVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSK 683

Query:    79 KRWERKQRARDRTVKFQGH 97
             +RWERK RARDR+VKFQGH
Sbjct:   684 RRWERKMRARDRSVKFQGH 702




GO:0005886 "plasma membrane" evidence=IDA;IMP;NAS
GO:0005918 "septate junction" evidence=NAS;TAS
GO:0007391 "dorsal closure" evidence=NAS;TAS
GO:0008104 "protein localization" evidence=IMP;TAS
GO:0007268 "synaptic transmission" evidence=IMP
GO:0004385 "guanylate kinase activity" evidence=TAS
GO:0016020 "membrane" evidence=TAS
GO:0005856 "cytoskeleton" evidence=NAS
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IGI
GO:0016327 "apicolateral plasma membrane" evidence=IDA
GO:0008283 "cell proliferation" evidence=TAS
GO:0016335 "morphogenesis of larval imaginal disc epithelium" evidence=TAS
GO:0016336 "establishment or maintenance of polarity of larval imaginal disc epithelium" evidence=NAS;TAS
GO:0016333 "morphogenesis of follicular epithelium" evidence=IMP
GO:0030710 "regulation of border follicle cell delamination" evidence=TAS
GO:0005938 "cell cortex" evidence=IDA
GO:0016332 "establishment or maintenance of polarity of embryonic epithelium" evidence=TAS
GO:0008105 "asymmetric protein localization" evidence=IMP;TAS
GO:0007399 "nervous system development" evidence=IMP
GO:0045175 "basal protein localization" evidence=NAS;IMP
GO:0045179 "apical cortex" evidence=IDA
GO:0005198 "structural molecule activity" evidence=TAS
GO:0045196 "establishment or maintenance of neuroblast polarity" evidence=TAS
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=NAS;TAS
GO:0002009 "morphogenesis of an epithelium" evidence=TAS
GO:0043195 "terminal bouton" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0042734 "presynaptic membrane" evidence=IDA
GO:0019991 "septate junction assembly" evidence=TAS
GO:0042127 "regulation of cell proliferation" evidence=TAS
GO:0007010 "cytoskeleton organization" evidence=NAS
GO:0051726 "regulation of cell cycle" evidence=NAS
GO:0005154 "epidermal growth factor receptor binding" evidence=TAS
GO:0008285 "negative regulation of cell proliferation" evidence=TAS
GO:0001738 "morphogenesis of a polarized epithelium" evidence=TAS
GO:0016323 "basolateral plasma membrane" evidence=TAS
GO:0045202 "synapse" evidence=IDA;TAS
GO:0045167 "asymmetric protein localization involved in cell fate determination" evidence=TAS
GO:0045211 "postsynaptic membrane" evidence=IDA
GO:0051294 "establishment of spindle orientation" evidence=IMP
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0008049 "male courtship behavior" evidence=IMP
GO:0045475 "locomotor rhythm" evidence=IMP
GO:0007617 "mating behavior" evidence=IMP
GO:0046956 "positive phototaxis" evidence=IMP
GO:0016328 "lateral plasma membrane" evidence=IDA
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0005920 "smooth septate junction" evidence=IDA
UNIPROTKB|F1MNQ1 DLG2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050221-3 dlg2 "discs, large (Drosophila) homolog 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1M907 Dlg2 "Disks large homolog 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F8W750 DLG2 "Disks large homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|619895 Dlg2 "discs, large homolog 2 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q15700 DLG2 "Disks large homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1344351 Dlg2 "discs, large homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPX2 DLG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:107231 Dlg1 "discs, large homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q63622DLG2_RATNo assigned EC number0.61790.42990.1044yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
cd1186161 cd11861, SH3_DLG-like, Src Homology 3 domain of Di 9e-40
cd1203274 cd12032, SH3_DLG2, Src Homology 3 domain of Disks 9e-33
cd1203167 cd12031, SH3_DLG1, Src Homology 3 domain of Disks 7e-29
cd1202967 cd12029, SH3_DLG3, Src Homology 3 domain of Disks 2e-27
cd1203066 cd12030, SH3_DLG4, Src Homology 3 domain of Disks 1e-25
cd1186261 cd11862, SH3_MPP, Src Homology 3 domain of Membran 1e-20
cd1203562 cd12035, SH3_MPP1-like, Src Homology 3 domain of M 1e-16
cd1203663 cd12036, SH3_MPP5, Src Homology 3 domain of Membra 3e-16
cd1208062 cd12080, SH3_MPP1, Src Homology 3 domain of Membra 3e-14
cd1203962 cd12039, SH3_MPP3, Src Homology 3 domain of Membra 5e-13
cd1208162 cd12081, SH3_CASK, Src Homology 3 domain of Calciu 2e-12
cd1203361 cd12033, SH3_MPP7, Src Homology 3 domain of Membra 2e-11
cd1203461 cd12034, SH3_MPP4, Src Homology 3 domain of Membra 3e-11
smart0032656 smart00326, SH3, Src homology 3 domains 2e-10
cd1203861 cd12038, SH3_MPP6, Src Homology 3 domain of Membra 4e-10
cd1203759 cd12037, SH3_MPP2, Src Homology 3 domain of Membra 5e-10
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 5e-10
cd1177357 cd11773, SH3_Sla1p_1, First Src Homology 3 domain 4e-09
pfam0001847 pfam00018, SH3_1, SH3 domain 1e-08
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 7e-08
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 7e-07
cd1185555 cd11855, SH3_Sho1p, Src homology 3 domain of High 3e-06
cd1180757 cd11807, SH3_ASPP, Src homology 3 domain of Apopto 9e-06
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 1e-05
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 1e-05
cd1175855 cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma 3e-05
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 4e-05
cd1200656 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn 5e-05
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 6e-05
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 8e-05
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 9e-05
cd1186362 cd11863, SH3_CACNB, Src Homology 3 domain of Volta 1e-04
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 2e-04
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 2e-04
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 2e-04
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 4e-04
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 5e-04
cd1200954 cd12009, SH3_Blk, Src homology 3 domain of Blk Pro 6e-04
cd1195357 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of 0.001
cd1187854 cd11878, SH3_Bem1p_1, First Src Homology 3 domain 0.002
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 0.002
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 0.002
cd1185962 cd11859, SH3_ZO, Src homology 3 domain of the Tigh 0.003
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 0.003
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 0.004
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 0.004
cd1204168 cd12041, SH3_CACNB1, Src Homology 3 domain of Volt 0.004
cd1195851 cd11958, SH3_RUSC1, Src homology 3 domain of RUN a 0.004
>gnl|CDD|212795 cd11861, SH3_DLG-like, Src Homology 3 domain of Disks large homolog proteins Back     alignment and domain information
 Score =  130 bits (328), Expect = 9e-40
 Identities = 43/61 (70%), Positives = 55/61 (90%)

Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
          + RALFDYDP++D GLPS+GL F +GDILHVTNASDDEWWQARRV P+G+E+ +G++PSK
Sbjct: 1  YVRALFDYDPSRDSGLPSQGLSFKFGDILHVTNASDDEWWQARRVTPNGEEEEVGVIPSK 60

Query: 79 K 79
          +
Sbjct: 61 R 61


The DLG-like proteins are scaffolding proteins that cluster at synapses and are also called PSD (postsynaptic density)-95 proteins or SAPs (synapse-associated proteins). They play important roles in synaptic development and plasticity, cell polarity, migration and proliferation. They are members of the MAGUK (membrane-associated guanylate kinase) protein family, which is characterized by the presence of a core of three domains: PDZ, SH3, and guanylate kinase (GuK). The GuK domain in MAGUK proteins is enzymatically inactive; instead, the domain mediates protein-protein interactions and associates intramolecularly with the SH3 domain. DLG-like proteins contain three PDZ domains and varying N-terminal regions. All DLG proteins exist as alternatively-spliced isoforms. Vertebrates contain four DLG proteins from different genes, called DLG1-4. DLG4 and DLG2 are found predominantly at postsynaptic sites and they mediate surface ion channel and receptor clustering. DLG3 is found axons and some presynaptic terminals. DLG1 interacts with AMPA-type glutamate receptors and is critical in their maturation and delivery to synapses. The SH3 domain of DLG4 binds and clusters the kainate subgroup of glutamate receptors via two proline-rich sequences in their C-terminal tail. It also binds AKAP79/150 (A-kinase anchoring protein). SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 61

>gnl|CDD|212965 cd12032, SH3_DLG2, Src Homology 3 domain of Disks Large homolog 2 Back     alignment and domain information
>gnl|CDD|212964 cd12031, SH3_DLG1, Src Homology 3 domain of Disks Large homolog 1 Back     alignment and domain information
>gnl|CDD|212962 cd12029, SH3_DLG3, Src Homology 3 domain of Disks Large homolog 3 Back     alignment and domain information
>gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog 4 Back     alignment and domain information
>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins Back     alignment and domain information
>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins Back     alignment and domain information
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) Back     alignment and domain information
>gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) Back     alignment and domain information
>gnl|CDD|212972 cd12039, SH3_MPP3, Src Homology 3 domain of Membrane Protein, Palmitoylated 3 (or MAGUK p55 subfamily member 3) Back     alignment and domain information
>gnl|CDD|213014 cd12081, SH3_CASK, Src Homology 3 domain of Calcium/calmodulin-dependent Serine protein Kinase Back     alignment and domain information
>gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) Back     alignment and domain information
>gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein, Palmitoylated 6 (or MAGUK p55 subfamily member 6) Back     alignment and domain information
>gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p Back     alignment and domain information
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212797 cd11863, SH3_CACNB, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 Back     alignment and domain information
>gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212793 cd11859, SH3_ZO, Src homology 3 domain of the Tight junction proteins, Zonula occludens (ZO) proteins Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212974 cd12041, SH3_CACNB1, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta-1 Back     alignment and domain information
>gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
KOG0708|consensus359 99.93
KOG3580|consensus 1027 99.84
KOG0609|consensus542 99.83
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.27
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.26
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.23
KOG2199|consensus462 99.07
KOG4792|consensus293 98.99
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.96
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.95
KOG3812|consensus 475 98.92
KOG2070|consensus 661 98.87
KOG1029|consensus1118 98.83
KOG1118|consensus366 98.79
KOG4226|consensus379 98.57
KOG0162|consensus1106 98.41
KOG4225|consensus489 98.38
KOG4348|consensus 627 98.29
KOG2856|consensus472 98.29
KOG4226|consensus379 98.29
KOG2996|consensus865 98.23
KOG0515|consensus752 98.1
KOG3601|consensus222 98.09
KOG4225|consensus489 98.03
KOG1264|consensus 1267 98.03
KOG3875|consensus362 98.01
KOG4348|consensus 627 97.96
KOG3655|consensus484 97.83
KOG2546|consensus483 97.74
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.69
KOG1843|consensus473 97.65
KOG0197|consensus 468 97.59
KOG1029|consensus 1118 97.45
KOG3632|consensus1335 97.09
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.08
KOG4278|consensus 1157 97.02
KOG2222|consensus 848 96.81
KOG1702|consensus264 96.68
KOG3771|consensus460 96.61
KOG4575|consensus 874 96.47
KOG3557|consensus721 96.41
KOG3523|consensus695 96.18
KOG3601|consensus222 95.41
KOG3775|consensus482 94.68
KOG4792|consensus293 93.85
KOG4773|consensus386 93.85
KOG1451|consensus812 93.55
KOG3632|consensus1335 93.05
KOG2528|consensus 490 93.02
KOG3725|consensus375 92.64
KOG0199|consensus 1039 91.09
KOG4429|consensus421 91.05
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 90.93
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 87.55
PLN02772 398 guanylate kinase 86.86
PRK10884206 SH3 domain-containing protein; Provisional 83.27
smart0028763 SH3b Bacterial SH3 domain homologues. 82.56
PRK14737186 gmk guanylate kinase; Provisional 81.12
>KOG0708|consensus Back     alignment and domain information
Probab=99.93  E-value=7.9e-28  Score=216.64  Aligned_cols=186  Identities=31%  Similarity=0.436  Sum_probs=153.9

Q ss_pred             CCceeEEEEeccCCCCCCCCCCCCCccCCCCCEEEEEEecCCCeeEEEEcCCCCCCceeeeecCChhHHhHhhhhccccc
Q psy10225         14 THLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVK   93 (207)
Q Consensus        14 ~~~s~~vRAlfdY~~~~d~~~P~~eLsF~kGDiL~Vl~~~d~~WW~ar~~~~~~~~~~~G~IPS~~~~E~~~~~~~~~~~   93 (207)
                      +.+..|++++|||+...+...|.+.++|..|++++++...+..||+++++..++.....|++|+....+++.++++++.+
T Consensus        63 ~~~~~~v~~~~d~d~~~~~~~~~~~~~~~~~~i~~~~~~~~~e~~~~r~~s~~~~~~~~~~~~~~~~~~rr~r~r~k~~~  142 (359)
T KOG0708|consen   63 EWRCLYVDALFDYDLDRGSPGYSRAQSFLYGQILHLISRSDDEWWQARHVSPRGEEKDVGLVPSKSRRARRVRLRLKRDS  142 (359)
T ss_pred             CCceeEeeccccccccCCCCCcchhhhhhhhhhhhccccccHHHHHhhccCCCccccccccccccccccccccccccccc
Confidence            36788999999999988777777799999999999999999999999999988888889999999999999999998888


Q ss_pred             cccccccc-ccccccc-----c---eeccccccc-------cccccceEEccCCcccccccccCCccCCcccccCCCcch
Q psy10225         94 FQGHVPVL-LEKVSIT-----Q---FSMIELNTI-------FKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGT  157 (207)
Q Consensus        94 f~~~~~~~-~~~~~~~-----~---~~~~~~~~~-------~~~~RPVvilgp~~dv~~~~L~~e~P~~~f~~~~~p~~t  157 (207)
                      |+.+.+.. +.+....     .   .+...+..|       +...|||+||||+.|..+++|+.|+|+ +| ++|+||++
T Consensus       143 f~~~~~~~~~~s~d~~~~~~~~~~~~~e~~~lsY~~V~~~~~~~~RPVlilg~~~d~l~~~Lv~e~~~-kF-~~C~~~t~  220 (359)
T KOG0708|consen  143 FNSGRDFPFLLSKDGLDMSSDENELGKELSLLSYELVERLDSNYLRPVLILGPLLDRLLDNLVNEFPD-KF-KSCLPETL  220 (359)
T ss_pred             ccccCCcccccCcccccccccccccccccccccchhhhhhhccccCceEeccchHHHHHHHHHHhhhc-cc-cccchhhh
Confidence            77652111 0011111     0   011112223       889999999999999999999999999 99 99999976


Q ss_pred             hH---HHHhhccceEEEE-------EEEEEEEEE-EEeccccc----------cccceeeEEEEe
Q psy10225        158 IR---RFQYGLKKIIQMF-------LYSVTVISI-AICLKNKH----------NELQEHHILVIN  201 (207)
Q Consensus       158 ~~---~~~~~~~~~~~~~-------~~~~~v~~~-~~~~~~~h----------~~~~~~~~~~~~  201 (207)
                      ++   .+|+.+++++||+       +|||||+|| +|++||.|          +|||+-+||=|-
T Consensus       221 ~~~~~eme~~~k~~~fI~~~q~~~~~~~tsv~si~~va~k~~HCiLdv~~~ai~rLq~~~IyPIv  285 (359)
T KOG0708|consen  221 RPSREEMERDSKEETFIDAGQRSNGLYGTSVASIREVAEKGKHCLLDVGGDAIRRLQRNQIYPIV  285 (359)
T ss_pred             cccHHHhhhhcccCceeeecccCCCcceehHHHHHHHhcCCCceEEecCcchHHHHHhcceeceE
Confidence            55   5999999999999       459999999 99999999          589999999763



>KOG3580|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
3tvt_A292 Structural Basis For Discs Large Interaction With P 5e-33
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 6e-28
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 9e-18
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 1e-17
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-17
1io6_A59 Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter 5e-04
1gcq_A61 Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt 5e-04
2vwf_A58 Grb2 Sh3c (2) Length = 58 5e-04
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure

Iteration: 1

Score = 137 bits (344), Expect = 5e-33, Method: Compositional matrix adjust. Identities = 60/80 (75%), Positives = 70/80 (87%) Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78 + RALFDYDP +DDGLPSRGLPF +GDILHVTNASDDEWWQARRVL +++ IGIVPSK Sbjct: 7 YVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSK 66 Query: 79 KRWERKQRARDRTVKFQGHV 98 +RWERK RARDR+VK + +V Sbjct: 67 RRWERKMRARDRSVKSEENV 86
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 Back     alignment and structure
>pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 4e-33
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 1e-31
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 2e-22
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-19
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 1e-17
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 7e-15
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-14
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 7e-12
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 9e-12
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 1e-11
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 1e-11
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 2e-11
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 3e-11
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 3e-11
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 6e-11
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 7e-11
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 2e-10
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 2e-10
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 2e-10
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 3e-10
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 5e-10
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 6e-10
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 6e-10
1awj_A77 ITK; transferase, regulatory intramolecular comple 7e-10
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 1e-09
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-09
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 2e-09
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 2e-09
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 2e-09
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 2e-09
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 2e-09
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 2e-09
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 2e-09
2cuc_A70 SH3 domain containing ring finger 2; structural ge 3e-09
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 3e-09
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 3e-09
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 6e-09
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 7e-09
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 9e-09
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 9e-09
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 9e-09
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 1e-08
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-08
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 1e-08
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 1e-08
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 1e-08
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 1e-08
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 1e-08
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 1e-08
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 1e-08
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 2e-08
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 2e-08
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 2e-08
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 2e-08
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 2e-08
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 2e-08
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 2e-08
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 2e-08
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 2e-08
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 3e-08
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 3e-08
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 3e-08
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 3e-08
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 3e-08
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 3e-08
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 3e-08
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 3e-08
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 3e-08
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 3e-08
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 4e-08
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 4e-08
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 4e-08
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 4e-08
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 4e-08
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 4e-08
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 5e-08
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 5e-08
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 5e-08
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 5e-08
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 6e-08
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 6e-08
1uti_A58 GRB2-related adaptor protein 2; signaling protein 6e-08
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 6e-08
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 6e-08
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 6e-08
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 6e-08
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 7e-08
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 7e-08
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 7e-08
1wxb_A68 Epidermal growth factor receptor pathway substrate 7e-08
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 7e-08
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 7e-08
2dil_A69 Proline-serine-threonine phosphatase-interacting p 8e-08
3u23_A65 CD2-associated protein; structural genomics, struc 8e-08
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 8e-08
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 9e-08
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 1e-07
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 1e-07
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 1e-07
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 1e-07
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 1e-07
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 1e-07
1i07_A60 Epidermal growth factor receptor kinase substrate 1e-07
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 2e-07
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 2e-07
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 2e-07
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 2e-07
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 2e-07
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 2e-07
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 2e-07
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 2e-07
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 2e-07
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 2e-07
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 2e-07
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 2e-07
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 2e-07
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 3e-07
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 3e-07
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 3e-07
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 3e-07
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 4e-07
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 4e-07
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 4e-07
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 4e-07
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 4e-07
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 5e-07
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 6e-07
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 6e-07
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 7e-07
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 8e-07
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 9e-07
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 1e-06
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 1e-06
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 2e-05
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 1e-06
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 1e-06
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-06
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-04
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 1e-06
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 1e-06
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 1e-06
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 2e-06
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-06
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-06
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 2e-06
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 2e-06
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 3e-06
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 3e-06
2da9_A70 SH3-domain kinase binding protein 1; structural ge 3e-06
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 3e-06
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 4e-06
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 6e-04
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 4e-06
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 4e-06
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 5e-06
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 5e-06
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 5e-06
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 5e-06
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 6e-06
2j6f_A62 CD2-associated protein; metal-binding, immune resp 6e-06
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 7e-06
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 8e-06
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 8e-06
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 9e-06
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 1e-05
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-05
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 1e-05
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 2e-05
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 2e-05
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-05
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 2e-05
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 3e-05
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-05
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 9e-05
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 9e-05
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 1e-04
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 1e-04
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-04
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 2e-04
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 2e-04
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 2e-04
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 3e-04
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 3e-04
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 4e-04
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 6e-04
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
 Score =  119 bits (300), Expect = 4e-33
 Identities = 38/79 (48%), Positives = 52/79 (65%)

Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
          + RALFDYD TKD G  S+ L F +GD+LHV +A D+EWWQARRV    +   IG +PSK
Sbjct: 3  YIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSK 62

Query: 79 KRWERKQRARDRTVKFQGH 97
          +R ER++ +R +   +   
Sbjct: 63 RRVERREWSRLKAKDWGSS 81


>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 99.97
3kfv_A308 Tight junction protein ZO-3; structural genomics c 99.93
1kjw_A295 Postsynaptic density protein 95; protein-protein i 99.91
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.91
4dey_A337 Voltage-dependent L-type calcium channel subunit; 99.87
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.83
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.83
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.51
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.46
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.43
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.42
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.42
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.41
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.41
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.41
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.41
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.4
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.4
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.4
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.39
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.39
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.39
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.39
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.39
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.39
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.38
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.38
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.38
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.38
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.38
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.38
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.38
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.38
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.38
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.38
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.37
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.37
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.37
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.37
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.37
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.36
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.36
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.36
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.36
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.36
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.36
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.36
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.36
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.35
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.35
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.35
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.35
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.35
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.35
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.34
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.34
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.34
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.34
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.34
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.34
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.34
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.34
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.33
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.33
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.33
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.33
3u23_A65 CD2-associated protein; structural genomics, struc 99.33
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.33
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.33
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.33
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.33
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.33
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.33
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.33
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.32
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.32
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.32
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.32
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.32
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.32
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.32
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.32
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.32
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.32
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.32
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.32
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.32
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.32
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.32
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.32
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.31
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.31
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.31
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.31
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.31
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.31
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.31
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.31
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.31
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.31
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.31
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.31
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.31
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.31
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.31
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.31
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.3
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.3
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.3
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.3
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.3
1i07_A60 Epidermal growth factor receptor kinase substrate 99.3
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.3
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.3
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.3
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.29
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.29
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.29
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.29
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.28
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.28
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.28
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.28
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.28
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.28
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.28
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.28
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.28
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.28
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.27
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.27
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.27
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.27
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.27
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.27
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.26
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.26
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.26
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.26
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.26
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.26
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.26
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.26
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.26
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.25
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.25
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.25
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.24
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.24
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.24
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.23
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.23
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.22
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.22
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.22
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.22
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.22
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.21
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.2
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.19
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.19
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.18
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.18
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.17
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.16
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.16
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.16
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.15
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.14
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.14
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.13
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.12
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.12
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.12
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.11
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.1
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.04
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.04
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.03
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.02
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.0
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.97
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.94
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 98.92
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.92
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.9
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.89
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.88
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.88
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.87
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.87
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.84
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.84
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.79
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.78
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.77
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.77
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.74
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.73
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.73
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.18
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.11
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.63
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.58
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.53
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.44
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.34
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 98.19
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 97.97
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 97.64
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 97.05
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 96.78
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.49
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 89.25
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 86.68
2kt8_A76 Probable surface protein; SH3 family, structural g 82.09
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 81.17
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
Probab=99.97  E-value=9.4e-33  Score=243.29  Aligned_cols=166  Identities=45%  Similarity=0.735  Sum_probs=117.9

Q ss_pred             CCCceeEEEEeccCCCCCCCCCCCCCccCCCCCEEEEEEecCCCeeEEEEcCCCCCCceeeeecCChhHHhHhhhhcccc
Q psy10225         13 STHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTV   92 (207)
Q Consensus        13 ~~~~s~~vRAlfdY~~~~d~~~P~~eLsF~kGDiL~Vl~~~d~~WW~ar~~~~~~~~~~~G~IPS~~~~E~~~~~~~~~~   92 (207)
                      +++++|||||+|||+|..|+++||++|+|++||||+|+++.|++||+|++++.++++.+.|+|||+.++|++.+.+....
T Consensus         1 ~~~~s~yvRa~fdY~~~~D~~~P~~gL~F~~gDiL~V~~~~d~~wWqA~~v~~~~~~~~~GlIPS~~~~e~~~~~~~~~~   80 (292)
T 3tvt_A            1 TQKRSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRRWERKMRARDRSV   80 (292)
T ss_dssp             ----CCEEEECSCBCC---------CCCBCTTCEEEEEECCSSSEEEECCCCC--------EEECHHHHHHHHHC-----
T ss_pred             CCCceEEEEEeccCCCCCCCCCCCCcCCcCCCCEEEEeecCCCCeEEEEEeCCCCCccceeEEeChHHHHHHHHHhhccc
Confidence            35789999999999999999999999999999999999999999999999987666778999999999998866554332


Q ss_pred             ccccccccccccccccceeccc--cccccccccceEEccCCcccccccccCCccCCcccccCCCcchh------------
Q psy10225         93 KFQGHVPVLLEKVSITQFSMIE--LNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTI------------  158 (207)
Q Consensus        93 ~f~~~~~~~~~~~~~~~~~~~~--~~~~~~~~RPVvilgp~~dv~~~~L~~e~P~~~f~~~~~p~~t~------------  158 (207)
                      +.            ...+..++  ....+.++|||||+||.++...++|.+++|+ +| +.++++|||            
T Consensus        81 ~~------------~~~~~~YE~V~~~~~~~~RpvVl~Gp~K~tl~~~Ll~~~p~-~f-~~sVs~TTR~pR~gE~dG~dY  146 (292)
T 3tvt_A           81 KS------------EENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPD-KF-GSCVPHTTRPKREYEVDGRDY  146 (292)
T ss_dssp             -----------------CCCEEEEEEEECSSCCCEEEESTTHHHHHHHHHHHCTT-TE-ECCCCEECSCCCTTCCBTTTB
T ss_pred             cc------------cccccchheEEeccCCCCCeEEEeCCCHHHHHHHHHHhChh-hc-cccccCCccCCcCCccCCccc
Confidence            21            11122222  1223779999999999999999999999999 99 999999877            


Q ss_pred             ------HHHHhhccceEEEE-------EEEEEEEEE-EEecccccccc
Q psy10225        159 ------RRFQYGLKKIIQMF-------LYSVTVISI-AICLKNKHNEL  192 (207)
Q Consensus       159 ------~~~~~~~~~~~~~~-------~~~~~v~~~-~~~~~~~h~~~  192 (207)
                            ..||+.++..-|+.       +|.|+..+| ++.++++||=|
T Consensus       147 ~Fv~s~e~fe~~i~~~~flE~a~~~gn~YGT~~~~V~~~~~~gk~viL  194 (292)
T 3tvt_A          147 HFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCIL  194 (292)
T ss_dssp             EECSCHHHHHHHHHTTCEEEEEEETTEEEEEEHHHHHHHHHHTCEEEE
T ss_pred             cccCCHHHHHHHHhcCceEEEEEEccceeEEehHHHHHHHHcCCcEEE
Confidence                  35888888888887       569999999 99999999644



>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 4e-23
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 9e-22
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 2e-21
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 2e-19
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 6e-10
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 7e-10
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-09
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 3e-09
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 5e-09
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 7e-09
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 8e-09
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 9e-09
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 9e-09
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 1e-08
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 1e-08
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 1e-08
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 1e-08
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 1e-08
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-08
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 5e-08
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 9e-08
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 1e-07
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 2e-07
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 2e-07
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 3e-07
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 4e-07
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-07
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 6e-07
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 7e-07
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 9e-07
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 9e-07
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 1e-06
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-06
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 4e-06
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 5e-06
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 5e-06
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 8e-06
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 1e-05
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 1e-05
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 2e-05
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 2e-05
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 3e-05
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-05
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 9e-05
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 1e-04
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 3e-04
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 4e-04
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Psd-95
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 86.7 bits (214), Expect = 4e-23
 Identities = 38/79 (48%), Positives = 52/79 (65%)

Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
          + RALFDYD TKD G  S+ L F +GD+LHV +A D+EWWQARRV    +   IG +PSK
Sbjct: 3  YIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSK 62

Query: 79 KRWERKQRARDRTVKFQGH 97
          +R ER++ +R +   +   
Sbjct: 63 RRVERREWSRLKAKDWGSS 81


>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.81
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.73
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.71
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.7
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.53
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.53
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.49
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.49
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.46
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.46
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.46
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.45
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.44
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.4
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.37
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.37
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.37
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.37
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.36
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.34
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.34
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.33
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.33
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.32
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.32
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.32
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.32
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.31
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.3
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.3
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.28
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.27
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.27
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.27
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.26
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.26
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.23
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.22
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.22
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.22
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.18
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.17
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.16
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.16
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.14
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.1
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 98.37
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.52
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.25
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 93.38
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.27
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 80.92
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Psd-95
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.81  E-value=1.3e-20  Score=138.38  Aligned_cols=77  Identities=49%  Similarity=0.886  Sum_probs=65.5

Q ss_pred             eeEEEEeccCCCCCCCCCCCCCccCCCCCEEEEEEecCCCeeEEEEcCCCCCCceeeeecCChhHHhHhhhhccccc
Q psy10225         17 FSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVK   93 (207)
Q Consensus        17 s~~vRAlfdY~~~~d~~~P~~eLsF~kGDiL~Vl~~~d~~WW~ar~~~~~~~~~~~G~IPS~~~~E~~~~~~~~~~~   93 (207)
                      .|||||+|||+++.++.+|+.+|+|++||+|+|+++.+++||+|+.++..+.+++.|+||++|+.|.+...+.....
T Consensus         1 ~~~vrAlydy~~~~d~~~~~~eLsf~kGdil~V~~~~d~~WW~~~~~~~~~~~g~~G~~Psnyv~e~~~~~~~~~~~   77 (96)
T d1kjwa1           1 GFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKD   77 (96)
T ss_dssp             CEEEEESSCBCHHHHHCCCSSBCCBCTTCEEEEEECCSSSEEEEEECCSSCCCSCCEEEECHHHHHHHHHTSCC---
T ss_pred             CEEEEEcccCcCCcCCCCCCccceEcCCCEEEEeeeccCceEEEEEccCCCCCCCEeEEeccceeeehhhhhccccc
Confidence            48999999999998776777899999999999999999999999998766667899999999999877766554443



>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure