Psyllid ID: psy10225
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| 242023647 | 473 | Discs large 1 tumor suppressor protein, | 0.425 | 0.186 | 0.840 | 4e-41 | |
| 189234387 | 729 | PREDICTED: similar to discs large 1 CG17 | 0.425 | 0.120 | 0.829 | 7e-40 | |
| 270001944 | 512 | hypothetical protein TcasGA2_TC000855 [T | 0.425 | 0.171 | 0.829 | 9e-40 | |
| 333033759 | 882 | discs large 1 [Gryllus bimaculatus] | 0.512 | 0.120 | 0.722 | 2e-39 | |
| 307175597 | 593 | Disks large 1 tumor suppressor protein [ | 0.425 | 0.148 | 0.795 | 8e-39 | |
| 322787023 | 500 | hypothetical protein SINV_09500 [Solenop | 0.420 | 0.174 | 0.793 | 1e-38 | |
| 383849085 | 946 | PREDICTED: disks large 1 tumor suppresso | 0.425 | 0.093 | 0.784 | 1e-38 | |
| 340722459 | 754 | PREDICTED: disks large 1 tumor suppresso | 0.425 | 0.116 | 0.784 | 1e-38 | |
| 380029430 | 636 | PREDICTED: disks large 1 tumor suppresso | 0.425 | 0.138 | 0.784 | 3e-38 | |
| 328713189 | 847 | PREDICTED: disks large homolog 1-like is | 0.454 | 0.110 | 0.712 | 5e-36 |
| >gi|242023647|ref|XP_002432243.1| Discs large 1 tumor suppressor protein, putative [Pediculus humanus corporis] gi|212517645|gb|EEB19505.1| Discs large 1 tumor suppressor protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 173 bits (438), Expect = 4e-41, Method: Compositional matrix adjust.
Identities = 74/88 (84%), Positives = 83/88 (94%)
Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
+ RALFDYDP KDDGLPSRGLPFHYGDILHVTNASDDEWWQAR+VLP+G+E+G+GIVPSK
Sbjct: 116 YVRALFDYDPNKDDGLPSRGLPFHYGDILHVTNASDDEWWQARKVLPTGEEEGMGIVPSK 175
Query: 79 KRWERKQRARDRTVKFQGHVPVLLEKVS 106
+RWERKQRARDRTVKFQGHVP ++K S
Sbjct: 176 RRWERKQRARDRTVKFQGHVPQNMDKQS 203
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189234387|ref|XP_001815997.1| PREDICTED: similar to discs large 1 CG1725-PK [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270001944|gb|EEZ98391.1| hypothetical protein TcasGA2_TC000855 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|333033759|dbj|BAK23256.1| discs large 1 [Gryllus bimaculatus] | Back alignment and taxonomy information |
|---|
| >gi|307175597|gb|EFN65507.1| Disks large 1 tumor suppressor protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322787023|gb|EFZ13247.1| hypothetical protein SINV_09500 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383849085|ref|XP_003700177.1| PREDICTED: disks large 1 tumor suppressor protein-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340722459|ref|XP_003399623.1| PREDICTED: disks large 1 tumor suppressor protein-like [Bombus terrestris] gi|350416652|ref|XP_003491037.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 1 [Bombus impatiens] gi|350416654|ref|XP_003491038.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380029430|ref|XP_003698376.1| PREDICTED: disks large 1 tumor suppressor protein-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328713189|ref|XP_001948578.2| PREDICTED: disks large homolog 1-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 207 | ||||||
| FB|FBgn0001624 | 970 | dlg1 "discs large 1" [Drosophi | 0.381 | 0.081 | 0.797 | 2e-31 | |
| UNIPROTKB|F1MNQ1 | 361 | DLG2 "Uncharacterized protein" | 0.425 | 0.243 | 0.625 | 6.6e-28 | |
| ZFIN|ZDB-GENE-050221-3 | 881 | dlg2 "discs, large (Drosophila | 0.439 | 0.103 | 0.615 | 3e-26 | |
| UNIPROTKB|F1M907 | 767 | Dlg2 "Disks large homolog 2" [ | 0.425 | 0.114 | 0.625 | 3.7e-26 | |
| UNIPROTKB|F8W750 | 221 | DLG2 "Disks large homolog 2" [ | 0.425 | 0.398 | 0.625 | 5.2e-26 | |
| RGD|619895 | 852 | Dlg2 "discs, large homolog 2 ( | 0.429 | 0.104 | 0.617 | 5.6e-26 | |
| UNIPROTKB|Q15700 | 870 | DLG2 "Disks large homolog 2" [ | 0.425 | 0.101 | 0.625 | 6e-26 | |
| MGI|MGI:1344351 | 852 | Dlg2 "discs, large homolog 2 ( | 0.429 | 0.104 | 0.617 | 1.2e-25 | |
| UNIPROTKB|F1NPX2 | 711 | DLG2 "Uncharacterized protein" | 0.367 | 0.106 | 0.684 | 1.2e-25 | |
| MGI|MGI:107231 | 905 | Dlg1 "discs, large homolog 1 ( | 0.367 | 0.083 | 0.671 | 2.4e-25 |
| FB|FBgn0001624 dlg1 "discs large 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 356 (130.4 bits), Expect = 2.0e-31, P = 2.0e-31
Identities = 63/79 (79%), Positives = 71/79 (89%)
Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
+ RALFDYDP +DDGLPSRGLPF +GDILHVTNASDDEWWQARRVL +++ IGIVPSK
Sbjct: 624 YVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSK 683
Query: 79 KRWERKQRARDRTVKFQGH 97
+RWERK RARDR+VKFQGH
Sbjct: 684 RRWERKMRARDRSVKFQGH 702
|
|
| UNIPROTKB|F1MNQ1 DLG2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050221-3 dlg2 "discs, large (Drosophila) homolog 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M907 Dlg2 "Disks large homolog 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W750 DLG2 "Disks large homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|619895 Dlg2 "discs, large homolog 2 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15700 DLG2 "Disks large homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1344351 Dlg2 "discs, large homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPX2 DLG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107231 Dlg1 "discs, large homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| cd11861 | 61 | cd11861, SH3_DLG-like, Src Homology 3 domain of Di | 9e-40 | |
| cd12032 | 74 | cd12032, SH3_DLG2, Src Homology 3 domain of Disks | 9e-33 | |
| cd12031 | 67 | cd12031, SH3_DLG1, Src Homology 3 domain of Disks | 7e-29 | |
| cd12029 | 67 | cd12029, SH3_DLG3, Src Homology 3 domain of Disks | 2e-27 | |
| cd12030 | 66 | cd12030, SH3_DLG4, Src Homology 3 domain of Disks | 1e-25 | |
| cd11862 | 61 | cd11862, SH3_MPP, Src Homology 3 domain of Membran | 1e-20 | |
| cd12035 | 62 | cd12035, SH3_MPP1-like, Src Homology 3 domain of M | 1e-16 | |
| cd12036 | 63 | cd12036, SH3_MPP5, Src Homology 3 domain of Membra | 3e-16 | |
| cd12080 | 62 | cd12080, SH3_MPP1, Src Homology 3 domain of Membra | 3e-14 | |
| cd12039 | 62 | cd12039, SH3_MPP3, Src Homology 3 domain of Membra | 5e-13 | |
| cd12081 | 62 | cd12081, SH3_CASK, Src Homology 3 domain of Calciu | 2e-12 | |
| cd12033 | 61 | cd12033, SH3_MPP7, Src Homology 3 domain of Membra | 2e-11 | |
| cd12034 | 61 | cd12034, SH3_MPP4, Src Homology 3 domain of Membra | 3e-11 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 2e-10 | |
| cd12038 | 61 | cd12038, SH3_MPP6, Src Homology 3 domain of Membra | 4e-10 | |
| cd12037 | 59 | cd12037, SH3_MPP2, Src Homology 3 domain of Membra | 5e-10 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 5e-10 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 4e-09 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 1e-08 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 7e-08 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 7e-07 | |
| cd11855 | 55 | cd11855, SH3_Sho1p, Src homology 3 domain of High | 3e-06 | |
| cd11807 | 57 | cd11807, SH3_ASPP, Src homology 3 domain of Apopto | 9e-06 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 1e-05 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 1e-05 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 3e-05 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 4e-05 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 5e-05 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 6e-05 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 8e-05 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 9e-05 | |
| cd11863 | 62 | cd11863, SH3_CACNB, Src Homology 3 domain of Volta | 1e-04 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 2e-04 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 2e-04 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 2e-04 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 4e-04 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 5e-04 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 6e-04 | |
| cd11953 | 57 | cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of | 0.001 | |
| cd11878 | 54 | cd11878, SH3_Bem1p_1, First Src Homology 3 domain | 0.002 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 0.002 | |
| cd11883 | 55 | cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 | 0.002 | |
| cd11859 | 62 | cd11859, SH3_ZO, Src homology 3 domain of the Tigh | 0.003 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 0.003 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 0.004 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 0.004 | |
| cd12041 | 68 | cd12041, SH3_CACNB1, Src Homology 3 domain of Volt | 0.004 | |
| cd11958 | 51 | cd11958, SH3_RUSC1, Src homology 3 domain of RUN a | 0.004 |
| >gnl|CDD|212795 cd11861, SH3_DLG-like, Src Homology 3 domain of Disks large homolog proteins | Back alignment and domain information |
|---|
Score = 130 bits (328), Expect = 9e-40
Identities = 43/61 (70%), Positives = 55/61 (90%)
Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
+ RALFDYDP++D GLPS+GL F +GDILHVTNASDDEWWQARRV P+G+E+ +G++PSK
Sbjct: 1 YVRALFDYDPSRDSGLPSQGLSFKFGDILHVTNASDDEWWQARRVTPNGEEEEVGVIPSK 60
Query: 79 K 79
+
Sbjct: 61 R 61
|
The DLG-like proteins are scaffolding proteins that cluster at synapses and are also called PSD (postsynaptic density)-95 proteins or SAPs (synapse-associated proteins). They play important roles in synaptic development and plasticity, cell polarity, migration and proliferation. They are members of the MAGUK (membrane-associated guanylate kinase) protein family, which is characterized by the presence of a core of three domains: PDZ, SH3, and guanylate kinase (GuK). The GuK domain in MAGUK proteins is enzymatically inactive; instead, the domain mediates protein-protein interactions and associates intramolecularly with the SH3 domain. DLG-like proteins contain three PDZ domains and varying N-terminal regions. All DLG proteins exist as alternatively-spliced isoforms. Vertebrates contain four DLG proteins from different genes, called DLG1-4. DLG4 and DLG2 are found predominantly at postsynaptic sites and they mediate surface ion channel and receptor clustering. DLG3 is found axons and some presynaptic terminals. DLG1 interacts with AMPA-type glutamate receptors and is critical in their maturation and delivery to synapses. The SH3 domain of DLG4 binds and clusters the kainate subgroup of glutamate receptors via two proline-rich sequences in their C-terminal tail. It also binds AKAP79/150 (A-kinase anchoring protein). SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 61 |
| >gnl|CDD|212965 cd12032, SH3_DLG2, Src Homology 3 domain of Disks Large homolog 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212964 cd12031, SH3_DLG1, Src Homology 3 domain of Disks Large homolog 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212962 cd12029, SH3_DLG3, Src Homology 3 domain of Disks Large homolog 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) | Back alignment and domain information |
|---|
| >gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) | Back alignment and domain information |
|---|
| >gnl|CDD|212972 cd12039, SH3_MPP3, Src Homology 3 domain of Membrane Protein, Palmitoylated 3 (or MAGUK p55 subfamily member 3) | Back alignment and domain information |
|---|
| >gnl|CDD|213014 cd12081, SH3_CASK, Src Homology 3 domain of Calcium/calmodulin-dependent Serine protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) | Back alignment and domain information |
|---|
| >gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein, Palmitoylated 6 (or MAGUK p55 subfamily member 6) | Back alignment and domain information |
|---|
| >gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p | Back alignment and domain information |
|---|
| >gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212797 cd11863, SH3_CACNB, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212793 cd11859, SH3_ZO, Src homology 3 domain of the Tight junction proteins, Zonula occludens (ZO) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212974 cd12041, SH3_CACNB1, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| KOG0708|consensus | 359 | 99.93 | ||
| KOG3580|consensus | 1027 | 99.84 | ||
| KOG0609|consensus | 542 | 99.83 | ||
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.27 | |
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.26 | |
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.23 | |
| KOG2199|consensus | 462 | 99.07 | ||
| KOG4792|consensus | 293 | 98.99 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 98.96 | |
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 98.95 | |
| KOG3812|consensus | 475 | 98.92 | ||
| KOG2070|consensus | 661 | 98.87 | ||
| KOG1029|consensus | 1118 | 98.83 | ||
| KOG1118|consensus | 366 | 98.79 | ||
| KOG4226|consensus | 379 | 98.57 | ||
| KOG0162|consensus | 1106 | 98.41 | ||
| KOG4225|consensus | 489 | 98.38 | ||
| KOG4348|consensus | 627 | 98.29 | ||
| KOG2856|consensus | 472 | 98.29 | ||
| KOG4226|consensus | 379 | 98.29 | ||
| KOG2996|consensus | 865 | 98.23 | ||
| KOG0515|consensus | 752 | 98.1 | ||
| KOG3601|consensus | 222 | 98.09 | ||
| KOG4225|consensus | 489 | 98.03 | ||
| KOG1264|consensus | 1267 | 98.03 | ||
| KOG3875|consensus | 362 | 98.01 | ||
| KOG4348|consensus | 627 | 97.96 | ||
| KOG3655|consensus | 484 | 97.83 | ||
| KOG2546|consensus | 483 | 97.74 | ||
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 97.69 | |
| KOG1843|consensus | 473 | 97.65 | ||
| KOG0197|consensus | 468 | 97.59 | ||
| KOG1029|consensus | 1118 | 97.45 | ||
| KOG3632|consensus | 1335 | 97.09 | ||
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 97.08 | |
| KOG4278|consensus | 1157 | 97.02 | ||
| KOG2222|consensus | 848 | 96.81 | ||
| KOG1702|consensus | 264 | 96.68 | ||
| KOG3771|consensus | 460 | 96.61 | ||
| KOG4575|consensus | 874 | 96.47 | ||
| KOG3557|consensus | 721 | 96.41 | ||
| KOG3523|consensus | 695 | 96.18 | ||
| KOG3601|consensus | 222 | 95.41 | ||
| KOG3775|consensus | 482 | 94.68 | ||
| KOG4792|consensus | 293 | 93.85 | ||
| KOG4773|consensus | 386 | 93.85 | ||
| KOG1451|consensus | 812 | 93.55 | ||
| KOG3632|consensus | 1335 | 93.05 | ||
| KOG2528|consensus | 490 | 93.02 | ||
| KOG3725|consensus | 375 | 92.64 | ||
| KOG0199|consensus | 1039 | 91.09 | ||
| KOG4429|consensus | 421 | 91.05 | ||
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 90.93 | |
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 87.55 | |
| PLN02772 | 398 | guanylate kinase | 86.86 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 83.27 | |
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 82.56 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 81.12 |
| >KOG0708|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=7.9e-28 Score=216.64 Aligned_cols=186 Identities=31% Similarity=0.436 Sum_probs=153.9
Q ss_pred CCceeEEEEeccCCCCCCCCCCCCCccCCCCCEEEEEEecCCCeeEEEEcCCCCCCceeeeecCChhHHhHhhhhccccc
Q psy10225 14 THLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVK 93 (207)
Q Consensus 14 ~~~s~~vRAlfdY~~~~d~~~P~~eLsF~kGDiL~Vl~~~d~~WW~ar~~~~~~~~~~~G~IPS~~~~E~~~~~~~~~~~ 93 (207)
+.+..|++++|||+...+...|.+.++|..|++++++...+..||+++++..++.....|++|+....+++.++++++.+
T Consensus 63 ~~~~~~v~~~~d~d~~~~~~~~~~~~~~~~~~i~~~~~~~~~e~~~~r~~s~~~~~~~~~~~~~~~~~~rr~r~r~k~~~ 142 (359)
T KOG0708|consen 63 EWRCLYVDALFDYDLDRGSPGYSRAQSFLYGQILHLISRSDDEWWQARHVSPRGEEKDVGLVPSKSRRARRVRLRLKRDS 142 (359)
T ss_pred CCceeEeeccccccccCCCCCcchhhhhhhhhhhhccccccHHHHHhhccCCCccccccccccccccccccccccccccc
Confidence 36788999999999988777777799999999999999999999999999988888889999999999999999998888
Q ss_pred cccccccc-ccccccc-----c---eeccccccc-------cccccceEEccCCcccccccccCCccCCcccccCCCcch
Q psy10225 94 FQGHVPVL-LEKVSIT-----Q---FSMIELNTI-------FKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGT 157 (207)
Q Consensus 94 f~~~~~~~-~~~~~~~-----~---~~~~~~~~~-------~~~~RPVvilgp~~dv~~~~L~~e~P~~~f~~~~~p~~t 157 (207)
|+.+.+.. +.+.... . .+...+..| +...|||+||||+.|..+++|+.|+|+ +| ++|+||++
T Consensus 143 f~~~~~~~~~~s~d~~~~~~~~~~~~~e~~~lsY~~V~~~~~~~~RPVlilg~~~d~l~~~Lv~e~~~-kF-~~C~~~t~ 220 (359)
T KOG0708|consen 143 FNSGRDFPFLLSKDGLDMSSDENELGKELSLLSYELVERLDSNYLRPVLILGPLLDRLLDNLVNEFPD-KF-KSCLPETL 220 (359)
T ss_pred ccccCCcccccCcccccccccccccccccccccchhhhhhhccccCceEeccchHHHHHHHHHHhhhc-cc-cccchhhh
Confidence 77652111 0011111 0 011112223 889999999999999999999999999 99 99999976
Q ss_pred hH---HHHhhccceEEEE-------EEEEEEEEE-EEeccccc----------cccceeeEEEEe
Q psy10225 158 IR---RFQYGLKKIIQMF-------LYSVTVISI-AICLKNKH----------NELQEHHILVIN 201 (207)
Q Consensus 158 ~~---~~~~~~~~~~~~~-------~~~~~v~~~-~~~~~~~h----------~~~~~~~~~~~~ 201 (207)
++ .+|+.+++++||+ +|||||+|| +|++||.| +|||+-+||=|-
T Consensus 221 ~~~~~eme~~~k~~~fI~~~q~~~~~~~tsv~si~~va~k~~HCiLdv~~~ai~rLq~~~IyPIv 285 (359)
T KOG0708|consen 221 RPSREEMERDSKEETFIDAGQRSNGLYGTSVASIREVAEKGKHCLLDVGGDAIRRLQRNQIYPIV 285 (359)
T ss_pred cccHHHhhhhcccCceeeecccCCCcceehHHHHHHHhcCCCceEEecCcchHHHHHhcceeceE
Confidence 55 5999999999999 459999999 99999999 589999999763
|
|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG3812|consensus | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 207 | ||||
| 3tvt_A | 292 | Structural Basis For Discs Large Interaction With P | 5e-33 | ||
| 3uat_A | 296 | Guanylate Kinase Domains Of The Maguk Family Scaffo | 6e-28 | ||
| 1jxm_A | 301 | Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag | 9e-18 | ||
| 1kjw_A | 295 | Sh3-Guanylate Kinase Module From Psd-95 Length = 29 | 1e-17 | ||
| 2xkx_A | 721 | Single Particle Analysis Of Psd-95 In Negative Stai | 1e-17 | ||
| 1io6_A | 59 | Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter | 5e-04 | ||
| 1gcq_A | 61 | Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt | 5e-04 | ||
| 2vwf_A | 58 | Grb2 Sh3c (2) Length = 58 | 5e-04 |
| >pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 | Back alignment and structure |
|
| >pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 | Back alignment and structure |
| >pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 | Back alignment and structure |
| >pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 | Back alignment and structure |
| >pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 | Back alignment and structure |
| >pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 | Back alignment and structure |
| >pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 | Back alignment and structure |
| >pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 207 | |||
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 4e-33 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 1e-31 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 2e-22 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 2e-19 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 1e-17 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 7e-15 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 1e-14 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 7e-12 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 9e-12 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 1e-11 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 1e-11 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 2e-11 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 3e-11 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 3e-11 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 6e-11 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 7e-11 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 2e-10 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 2e-10 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 2e-10 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 3e-10 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 5e-10 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 6e-10 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 6e-10 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 7e-10 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 1e-09 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 1e-09 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 2e-09 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 2e-09 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 2e-09 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 2e-09 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 2e-09 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-09 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 2e-09 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 3e-09 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 3e-09 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 3e-09 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 6e-09 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 7e-09 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 9e-09 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 9e-09 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 9e-09 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 1e-08 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 1e-08 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 1e-08 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 1e-08 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 1e-08 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 1e-08 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 1e-08 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 1e-08 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 1e-08 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 2e-08 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 2e-08 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-08 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 2e-08 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 2e-08 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 2e-08 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 2e-08 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 2e-08 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 2e-08 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 3e-08 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 3e-08 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 3e-08 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 3e-08 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 3e-08 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 3e-08 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 3e-08 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 3e-08 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 3e-08 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 3e-08 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 4e-08 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 4e-08 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 4e-08 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 4e-08 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 4e-08 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 4e-08 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 5e-08 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 5e-08 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 5e-08 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 5e-08 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 6e-08 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 6e-08 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 6e-08 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 6e-08 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 6e-08 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 6e-08 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 6e-08 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 7e-08 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 7e-08 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 7e-08 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 7e-08 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 7e-08 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 7e-08 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 8e-08 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 8e-08 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 8e-08 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 9e-08 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 1e-07 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 1e-07 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 1e-07 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 1e-07 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 1e-07 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 1e-07 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 1e-07 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 2e-07 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 2e-07 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 2e-07 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 2e-07 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 2e-07 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 2e-07 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 2e-07 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 2e-07 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 2e-07 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 2e-07 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 2e-07 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 2e-07 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 2e-07 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 3e-07 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 3e-07 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 3e-07 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 3e-07 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 4e-07 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 4e-07 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 4e-07 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 4e-07 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 4e-07 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 5e-07 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 6e-07 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 6e-07 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 7e-07 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 8e-07 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 9e-07 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 1e-06 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 1e-06 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 2e-05 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 1e-06 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 1e-06 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 1e-06 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 1e-04 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 1e-06 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 1e-06 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 1e-06 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 2e-06 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-06 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 2e-06 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 2e-06 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 2e-06 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 3e-06 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 3e-06 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 3e-06 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 3e-06 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 4e-06 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 6e-04 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 4e-06 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 4e-06 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 5e-06 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 5e-06 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 5e-06 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 5e-06 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 6e-06 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 6e-06 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 7e-06 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 8e-06 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 8e-06 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 9e-06 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 1e-05 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 1e-05 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 1e-05 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 2e-05 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 2e-05 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 2e-05 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 2e-05 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 3e-05 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 6e-05 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 9e-05 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 9e-05 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 1e-04 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 1e-04 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 2e-04 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 2e-04 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 2e-04 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 2e-04 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 3e-04 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 3e-04 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 4e-04 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 6e-04 |
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 | Back alignment and structure |
|---|
Score = 119 bits (300), Expect = 4e-33
Identities = 38/79 (48%), Positives = 52/79 (65%)
Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
+ RALFDYD TKD G S+ L F +GD+LHV +A D+EWWQARRV + IG +PSK
Sbjct: 3 YIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSK 62
Query: 79 KRWERKQRARDRTVKFQGH 97
+R ER++ +R + +
Sbjct: 63 RRVERREWSRLKAKDWGSS 81
|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 99.97 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 99.93 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 99.91 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 99.91 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 99.87 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 99.83 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 99.83 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.51 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.46 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.43 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.42 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.42 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.41 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.41 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.41 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.41 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.4 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.4 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.4 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.39 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.39 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.39 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.39 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.39 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.39 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.38 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.38 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.38 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.38 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.38 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.38 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.38 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.38 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.38 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.38 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.37 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.37 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.37 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.37 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.37 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.36 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.36 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.36 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.36 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.36 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.36 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.36 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.36 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.35 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.35 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.35 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.35 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.35 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.35 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.34 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.34 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.34 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.34 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.34 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.34 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.34 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.34 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.33 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.33 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.33 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.33 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.33 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.33 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.33 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.33 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.33 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.33 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.33 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.33 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.32 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.32 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.32 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.32 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.32 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.32 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.32 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.32 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.32 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.32 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.32 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.32 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.32 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.32 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.32 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.32 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.31 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.31 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.31 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.31 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.31 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.31 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.31 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.31 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.31 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.31 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.31 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.31 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.31 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.31 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.31 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.31 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.3 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.3 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.3 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.3 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.3 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.3 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.3 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.3 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.3 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.29 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.29 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.29 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.29 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.28 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.28 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.28 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.28 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.28 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.28 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.28 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.28 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.28 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.28 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.27 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.27 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.27 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.27 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.27 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.27 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.26 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.26 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.26 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.26 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.26 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.26 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.26 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.26 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.26 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.25 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.25 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.25 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.24 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.24 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.24 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.23 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.23 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.22 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.22 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.22 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.22 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.22 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.21 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.2 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.19 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.19 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.18 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.18 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.17 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.16 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.16 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.16 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.15 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.14 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.14 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.13 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.12 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.12 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.12 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.11 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.1 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.04 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 99.04 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 99.03 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 99.02 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.0 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 98.97 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 98.94 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 98.92 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 98.92 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 98.9 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 98.89 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 98.88 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 98.88 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 98.87 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 98.87 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 98.84 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 98.84 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 98.79 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 98.78 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 98.77 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 98.77 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 98.74 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 98.73 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 98.73 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.18 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.11 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 98.63 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 98.58 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 98.53 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 98.44 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.34 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 98.31 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 98.19 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 97.97 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 97.97 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 97.64 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 97.05 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 96.78 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 95.49 | |
| 1wfw_A | 74 | Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex | 89.25 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 86.68 | |
| 2kt8_A | 76 | Probable surface protein; SH3 family, structural g | 82.09 | |
| 2krs_A | 74 | Probable enterotoxin; all beta, SH3, ENTD, CPF_058 | 81.17 |
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
Probab=99.97 E-value=9.4e-33 Score=243.29 Aligned_cols=166 Identities=45% Similarity=0.735 Sum_probs=117.9
Q ss_pred CCCceeEEEEeccCCCCCCCCCCCCCccCCCCCEEEEEEecCCCeeEEEEcCCCCCCceeeeecCChhHHhHhhhhcccc
Q psy10225 13 STHLFSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTV 92 (207)
Q Consensus 13 ~~~~s~~vRAlfdY~~~~d~~~P~~eLsF~kGDiL~Vl~~~d~~WW~ar~~~~~~~~~~~G~IPS~~~~E~~~~~~~~~~ 92 (207)
+++++|||||+|||+|..|+++||++|+|++||||+|+++.|++||+|++++.++++.+.|+|||+.++|++.+.+....
T Consensus 1 ~~~~s~yvRa~fdY~~~~D~~~P~~gL~F~~gDiL~V~~~~d~~wWqA~~v~~~~~~~~~GlIPS~~~~e~~~~~~~~~~ 80 (292)
T 3tvt_A 1 TQKRSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRRWERKMRARDRSV 80 (292)
T ss_dssp ----CCEEEECSCBCC---------CCCBCTTCEEEEEECCSSSEEEECCCCC--------EEECHHHHHHHHHC-----
T ss_pred CCCceEEEEEeccCCCCCCCCCCCCcCCcCCCCEEEEeecCCCCeEEEEEeCCCCCccceeEEeChHHHHHHHHHhhccc
Confidence 35789999999999999999999999999999999999999999999999987666778999999999998866554332
Q ss_pred ccccccccccccccccceeccc--cccccccccceEEccCCcccccccccCCccCCcccccCCCcchh------------
Q psy10225 93 KFQGHVPVLLEKVSITQFSMIE--LNTIFKLIEKSVALGLTRGLKAGQMTSNFKEHKYLDLDVPIGTI------------ 158 (207)
Q Consensus 93 ~f~~~~~~~~~~~~~~~~~~~~--~~~~~~~~RPVvilgp~~dv~~~~L~~e~P~~~f~~~~~p~~t~------------ 158 (207)
+. ...+..++ ....+.++|||||+||.++...++|.+++|+ +| +.++++|||
T Consensus 81 ~~------------~~~~~~YE~V~~~~~~~~RpvVl~Gp~K~tl~~~Ll~~~p~-~f-~~sVs~TTR~pR~gE~dG~dY 146 (292)
T 3tvt_A 81 KS------------EENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPD-KF-GSCVPHTTRPKREYEVDGRDY 146 (292)
T ss_dssp -----------------CCCEEEEEEEECSSCCCEEEESTTHHHHHHHHHHHCTT-TE-ECCCCEECSCCCTTCCBTTTB
T ss_pred cc------------cccccchheEEeccCCCCCeEEEeCCCHHHHHHHHHHhChh-hc-cccccCCccCCcCCccCCccc
Confidence 21 11122222 1223779999999999999999999999999 99 999999877
Q ss_pred ------HHHHhhccceEEEE-------EEEEEEEEE-EEecccccccc
Q psy10225 159 ------RRFQYGLKKIIQMF-------LYSVTVISI-AICLKNKHNEL 192 (207)
Q Consensus 159 ------~~~~~~~~~~~~~~-------~~~~~v~~~-~~~~~~~h~~~ 192 (207)
..||+.++..-|+. +|.|+..+| ++.++++||=|
T Consensus 147 ~Fv~s~e~fe~~i~~~~flE~a~~~gn~YGT~~~~V~~~~~~gk~viL 194 (292)
T 3tvt_A 147 HFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCIL 194 (292)
T ss_dssp EECSCHHHHHHHHHTTCEEEEEEETTEEEEEEHHHHHHHHHHTCEEEE
T ss_pred cccCCHHHHHHHHhcCceEEEEEEccceeEEehHHHHHHHHcCCcEEE
Confidence 35888888888887 569999999 99999999644
|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A | Back alignment and structure |
|---|
| >2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 207 | ||||
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 4e-23 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 9e-22 | |
| d1vyua1 | 136 | b.34.2.1 (A:39-174) SH3-like domain of the L-type | 2e-21 | |
| d1vyva1 | 145 | b.34.2.1 (A:71-215) SH3-like domain of the L-type | 2e-19 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 6e-10 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 7e-10 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 1e-09 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 3e-09 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 5e-09 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 7e-09 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 8e-09 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 9e-09 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 9e-09 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 1e-08 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 1e-08 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 1e-08 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 1e-08 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 1e-08 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 4e-08 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 5e-08 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 9e-08 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 1e-07 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 2e-07 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 2e-07 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 3e-07 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 4e-07 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-07 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 6e-07 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 7e-07 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 9e-07 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 9e-07 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 1e-06 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-06 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 4e-06 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 5e-06 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 5e-06 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 8e-06 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 1e-05 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 1e-05 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 2e-05 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 2e-05 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 3e-05 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-05 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 9e-05 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 1e-04 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 3e-04 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 4e-04 |
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Psd-95 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 86.7 bits (214), Expect = 4e-23
Identities = 38/79 (48%), Positives = 52/79 (65%)
Query: 19 FSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSK 78
+ RALFDYD TKD G S+ L F +GD+LHV +A D+EWWQARRV + IG +PSK
Sbjct: 3 YIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSK 62
Query: 79 KRWERKQRARDRTVKFQGH 97
+R ER++ +R + +
Sbjct: 63 RRVERREWSRLKAKDWGSS 81
|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 207 | |||
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.81 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.73 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 99.71 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 99.7 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.53 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.53 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.49 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.49 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.46 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.46 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.46 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.45 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.44 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.4 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.37 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.37 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.37 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.37 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.36 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.34 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.34 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.33 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.33 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.32 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.32 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.32 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.32 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.31 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.3 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.3 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.28 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.27 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.27 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.27 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.26 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.26 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.23 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.22 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.22 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.22 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.18 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.17 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.16 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.16 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.14 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.1 | |
| d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 98.37 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 96.52 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.25 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 93.38 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 92.27 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 80.92 |
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Psd-95 species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.81 E-value=1.3e-20 Score=138.38 Aligned_cols=77 Identities=49% Similarity=0.886 Sum_probs=65.5
Q ss_pred eeEEEEeccCCCCCCCCCCCCCccCCCCCEEEEEEecCCCeeEEEEcCCCCCCceeeeecCChhHHhHhhhhccccc
Q psy10225 17 FSFSRALFDYDPTKDDGLPSRGLPFHYGDILHVTNASDDEWWQARRVLPSGDEQGIGIVPSKKRWERKQRARDRTVK 93 (207)
Q Consensus 17 s~~vRAlfdY~~~~d~~~P~~eLsF~kGDiL~Vl~~~d~~WW~ar~~~~~~~~~~~G~IPS~~~~E~~~~~~~~~~~ 93 (207)
.|||||+|||+++.++.+|+.+|+|++||+|+|+++.+++||+|+.++..+.+++.|+||++|+.|.+...+.....
T Consensus 1 ~~~vrAlydy~~~~d~~~~~~eLsf~kGdil~V~~~~d~~WW~~~~~~~~~~~g~~G~~Psnyv~e~~~~~~~~~~~ 77 (96)
T d1kjwa1 1 GFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKD 77 (96)
T ss_dssp CEEEEESSCBCHHHHHCCCSSBCCBCTTCEEEEEECCSSSEEEEEECCSSCCCSCCEEEECHHHHHHHHHTSCC---
T ss_pred CEEEEEcccCcCCcCCCCCCccceEcCCCEEEEeeeccCceEEEEEccCCCCCCCEeEEeccceeeehhhhhccccc
Confidence 48999999999998776777899999999999999999999999998766667899999999999877766554443
|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|