Diaphorina citri psyllid: psy10233


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
ccHHHHHHHHHHccccccccccccEEEccccccEEccccccccccEEEcccccccccccccccccccEEEccccccEEEEcccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccCEEccccccccHHHHHHHcccccccEEEccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHcc
*TKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein assembly factor 1, axonemal Cilium-specific protein required for the stability of the ciliary architecture. Plays a role in cytoplasmic preassembly of dynein arms (By similarity). Involved in regulation of microtubule-based cilia and actin-based brush border microvilli.confidentQ3SYS4
Dynein assembly factor 1, axonemal Cilium-specific protein required for the stability of the ciliary architecture. Plays a role in cytoplasmic preassembly of dynein arms (By similarity). Involved in regulation of microtubule-based cilia and actin-based brush border microvilli.confidentQ9D2H9
Dynein assembly factor 1, axonemal Cilium-specific protein required for the stability of the ciliary architecture. Plays a role in cytoplasmic preassembly of dynein arms (By similarity). Involved in regulation of microtubule-based cilia and actin-based brush border microvilli.confidentQ6AYH9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0071907 [BP]determination of digestive tract left/right asymmetryprobableGO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0007389, GO:0007368, GO:0048856, GO:0044767, GO:0008150, GO:0009855, GO:0009799, GO:0048731, GO:0007275, GO:0044699
GO:0060972 [BP]left/right pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0035469 [BP]determination of pancreatic left/right asymmetryprobableGO:0032502, GO:0007389, GO:0048856, GO:0044707, GO:0032501, GO:0007368, GO:0031016, GO:0044767, GO:0048513, GO:0008150, GO:0009855, GO:0009799, GO:0048731, GO:0007275, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044458 [BP]motile cilium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0042384, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0045502 [MF]dynein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0001947 [BP]heart loopingprobableGO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731
GO:0030324 [BP]lung developmentprobableGO:0060541, GO:0032502, GO:0030323, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0036159 [BP]inner dynein arm assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0070286, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0036158 [BP]outer dynein arm assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0070286, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0003341 [BP]cilium movementprobableGO:0007017, GO:0009987, GO:0007018, GO:0006928, GO:0044763, GO:0008150, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003356 [BP]regulation of cilium beat frequencyprobableGO:0051270, GO:0060632, GO:0050794, GO:0050789, GO:0065007, GO:0008150, GO:0032886, GO:0032879, GO:0003352
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0071910 [BP]determination of liver left/right asymmetryprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0061008, GO:0007368, GO:0048856, GO:0044767, GO:0048513, GO:0001889, GO:0008150, GO:0009855, GO:0009799, GO:0048731, GO:0007275, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FMZ, chain A
Confidence level:very confident
Coverage over the Query: 23-196
View the alignment between query and template
View the model in PyMOL
Template: 1A9N, chain A
Confidence level:very confident
Coverage over the Query: 60-207
View the alignment between query and template
View the model in PyMOL