Psyllid ID: psy10233


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
ccHHHHHHHHHHccccccccccccEEEccccccEEccccccccccEEEcccccccccccccccccccEEEccccccEEEEcccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccHHHHHHHcccccccEEEccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHcc
ccHHHHHHHHHHccccccccHccEEEEcccccEEcHHHcccccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHcccccccEEEcccccccccHHHcccccccEEEcEEccccccccHHHHHHHHcccccEEEEEcccHHHHccHcHHHHHHHHHHcccEcccccccHHHHHHHHcc
MTKASLRKICkdnklyltpslndvlylHFKGYTVIENLeeytglkclwlenngiskienldAQTEMRSIYMHHNLVKVMENLshmqlldtINLSHNFIEKIenlsclpvlrtlhLSHNRLKTIediehlkdcpllsivdvshnqiedeeVIEVFGAMPELRVLtlshnpcvgkikNYRRMFINLCVNlrhlddypvfdkdrkcaeaw
mtkaslrkickdnklyltpslndvLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEdiehlkdcplLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNlrhlddypvfdkDRKCAEAW
MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
*******KICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDK********
*TKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
*TKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
Q8NEP3 725 Dynein assembly factor 1, yes N/A 1.0 0.285 0.584 2e-73
Q3SYS4 643 Dynein assembly factor 1, yes N/A 1.0 0.321 0.579 7e-71
Q9D2H9 634 Dynein assembly factor 1, yes N/A 1.0 0.326 0.584 3e-69
Q6AYH9 633 Dynein assembly factor 1, yes N/A 1.0 0.327 0.584 4e-69
B6D5P1 622 Dynein assembly factor 1, N/A N/A 1.0 0.332 0.579 1e-68
B6D5P6 622 Dynein assembly factor 1, N/A N/A 1.0 0.332 0.579 2e-68
B6D5P3 622 Dynein assembly factor 1, N/A N/A 1.0 0.332 0.579 3e-68
Q7PK92 910 Dynein assembly factor 1, yes N/A 1.0 0.227 0.559 2e-63
Q16RY9 1107 Dynein assembly factor 1, N/A N/A 1.0 0.186 0.550 1e-62
Q7ZV84 555 Dynein assembly factor 1, yes N/A 1.0 0.372 0.550 2e-61
>sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 Back     alignment and function desciption
 Score =  275 bits (703), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 121/207 (58%), Positives = 165/207 (79%)

Query: 1   MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENL 60
           MTK+SL+K+CK +KLY+TP+LND LYLHFKG+  IENLEEYTGL+CLWL++NGI KIENL
Sbjct: 88  MTKSSLQKLCKQHKLYITPALNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENL 147

Query: 61  DAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRL 120
           +AQTE+R +++  NL++ +ENL  +Q LD +NLS+N+I+ IENLSCLPVL TL ++HN L
Sbjct: 148 EAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHL 207

Query: 121 KTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRM 180
           +T+EDI+HL++C  L ++D+SHN++ D E++ +  +MP+LRVL L  NP + +I NYRR 
Sbjct: 208 ETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRT 267

Query: 181 FINLCVNLRHLDDYPVFDKDRKCAEAW 207
                 +L +LDD PVF KDR CAEAW
Sbjct: 268 VTVRLKHLTYLDDRPVFPKDRACAEAW 294




Cilium-specific protein required for the stability of the ciliary architecture. Plays a role in cytoplasmic preassembly of dynein arms. Involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
Homo sapiens (taxid: 9606)
>sp|Q3SYS4|DAAF1_BOVIN Dynein assembly factor 1, axonemal OS=Bos taurus GN=DNAAF1 PE=2 SV=2 Back     alignment and function description
>sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|Q6AYH9|DAAF1_RAT Dynein assembly factor 1, axonemal OS=Rattus norvegicus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|B6D5P1|DAAF1_PERPL Dynein assembly factor 1, axonemal OS=Peromyscus polionotus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|B6D5P6|DAAF1_PERCA Dynein assembly factor 1, axonemal OS=Peromyscus californicus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|B6D5P3|DAAF1_PERLE Dynein assembly factor 1, axonemal OS=Peromyscus leucopus GN=Dnaaf1 PE=2 SV=1 Back     alignment and function description
>sp|Q7PK92|DAAF1_ANOGA Dynein assembly factor 1, axonemal homolog OS=Anopheles gambiae GN=AGAP009594 PE=3 SV=2 Back     alignment and function description
>sp|Q16RY9|DAAF1_AEDAE Dynein assembly factor 1, axonemal homolog OS=Aedes aegypti GN=AAEL010772 PE=3 SV=1 Back     alignment and function description
>sp|Q7ZV84|DAAF1_DANRE Dynein assembly factor 1, axonemal OS=Danio rerio GN=dnaaf1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
71052109 725 Leucine rich repeat containing 50 [Homo 1.0 0.285 0.584 4e-72
119615906 725 leucine rich repeat containing 50, isofo 1.0 0.285 0.584 6e-72
157674358 725 dynein assembly factor 1, axonemal [Homo 1.0 0.285 0.584 8e-72
402909167 725 PREDICTED: LOW QUALITY PROTEIN: dynein a 1.0 0.285 0.584 2e-71
426383078 725 PREDICTED: dynein assembly factor 1, axo 1.0 0.285 0.579 3e-71
114663880 725 PREDICTED: dynein assembly factor 1, axo 1.0 0.285 0.584 6e-71
410984085 760 PREDICTED: dynein assembly factor 1, axo 1.0 0.272 0.579 1e-70
397500525 638 PREDICTED: dynein assembly factor 1, axo 1.0 0.324 0.584 1e-70
297699333 709 PREDICTED: dynein assembly factor 1, axo 1.0 0.291 0.579 3e-70
332246859 681 PREDICTED: LOW QUALITY PROTEIN: dynein a 1.0 0.303 0.579 2e-69
>gi|71052109|gb|AAH24009.3| Leucine rich repeat containing 50 [Homo sapiens] Back     alignment and taxonomy information
 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 121/207 (58%), Positives = 165/207 (79%)

Query: 1   MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENL 60
           MTK+SL+K+CK +KLY+TP+LND LYLHFKG+  IENLEEYTGL+CLWL++NGI KIENL
Sbjct: 88  MTKSSLQKLCKQHKLYITPALNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENL 147

Query: 61  DAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRL 120
           +AQTE+R +++  NL++ +ENL  +Q LD +NLS+N+I+ IENLSCLPVL TL ++HN L
Sbjct: 148 EAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHL 207

Query: 121 KTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRM 180
           +T+EDI+HL++C  L ++D+SHN++ D E++ +  +MP+LRVL L  NP + +I NYRR 
Sbjct: 208 ETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRT 267

Query: 181 FINLCVNLRHLDDYPVFDKDRKCAEAW 207
                 +L +LDD PVF KDR CAEAW
Sbjct: 268 VTVRLKHLTYLDDRPVFPKDRACAEAW 294




Source: Homo sapiens

Species: Homo sapiens

Genus: Homo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|119615906|gb|EAW95500.1| leucine rich repeat containing 50, isoform CRA_a [Homo sapiens] Back     alignment and taxonomy information
>gi|157674358|ref|NP_848547.4| dynein assembly factor 1, axonemal [Homo sapiens] gi|215274261|sp|Q8NEP3.5|DAAF1_HUMAN RecName: Full=Dynein assembly factor 1, axonemal; AltName: Full=Leucine-rich repeat-containing protein 50 Back     alignment and taxonomy information
>gi|402909167|ref|XP_003917296.1| PREDICTED: LOW QUALITY PROTEIN: dynein assembly factor 1, axonemal [Papio anubis] Back     alignment and taxonomy information
>gi|426383078|ref|XP_004058120.1| PREDICTED: dynein assembly factor 1, axonemal [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|114663880|ref|XP_511137.2| PREDICTED: dynein assembly factor 1, axonemal [Pan troglodytes] Back     alignment and taxonomy information
>gi|410984085|ref|XP_003998362.1| PREDICTED: dynein assembly factor 1, axonemal [Felis catus] Back     alignment and taxonomy information
>gi|397500525|ref|XP_003820961.1| PREDICTED: dynein assembly factor 1, axonemal [Pan paniscus] Back     alignment and taxonomy information
>gi|297699333|ref|XP_002826749.1| PREDICTED: dynein assembly factor 1, axonemal [Pongo abelii] Back     alignment and taxonomy information
>gi|332246859|ref|XP_003272572.1| PREDICTED: LOW QUALITY PROTEIN: dynein assembly factor 1, axonemal [Nomascus leucogenys] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
UNIPROTKB|Q8NEP3 725 DNAAF1 "Dynein assembly factor 1.0 0.285 0.584 4e-67
UNIPROTKB|F1MTA8 643 DNAAF1 "Dynein assembly factor 1.0 0.321 0.579 7.4e-66
UNIPROTKB|Q3SYS4 643 DNAAF1 "Dynein assembly factor 1.0 0.321 0.579 7.4e-66
UNIPROTKB|F1S5U4 630 DNAAF1 "Uncharacterized protei 1.0 0.328 0.584 8.5e-65
MGI|MGI:1915520 634 Dnaaf1 "dynein, axonemal assem 1.0 0.326 0.584 9.7e-64
RGD|1310542 633 Dnaaf1 "dynein, axonemal, asse 1.0 0.327 0.584 9.7e-64
UNIPROTKB|B6D5P1 622 Dnaaf1 "Dynein assembly factor 1.0 0.332 0.579 1.6e-63
UNIPROTKB|B6D5P3 622 Dnaaf1 "Dynein assembly factor 1.0 0.332 0.579 1.6e-63
UNIPROTKB|B6D5P6 622 Dnaaf1 "Dynein assembly factor 1.0 0.332 0.579 4.2e-63
UNIPROTKB|E1C8P9253 DNAAF1 "Uncharacterized protei 1.0 0.818 0.550 1.6e-61
UNIPROTKB|Q8NEP3 DNAAF1 "Dynein assembly factor 1, axonemal" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 682 (245.1 bits), Expect = 4.0e-67, P = 4.0e-67
 Identities = 121/207 (58%), Positives = 165/207 (79%)

Query:     1 MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENL 60
             MTK+SL+K+CK +KLY+TP+LND LYLHFKG+  IENLEEYTGL+CLWL++NGI KIENL
Sbjct:    88 MTKSSLQKLCKQHKLYITPALNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENL 147

Query:    61 DAQTEMRSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRL 120
             +AQTE+R +++  NL++ +ENL  +Q LD +NLS+N+I+ IENLSCLPVL TL ++HN L
Sbjct:   148 EAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHL 207

Query:   121 KTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRM 180
             +T+EDI+HL++C  L ++D+SHN++ D E++ +  +MP+LRVL L  NP + +I NYRR 
Sbjct:   208 ETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRT 267

Query:   181 FINLCVNLRHLDDYPVFDKDRKCAEAW 207
                   +L +LDD PVF KDR CAEAW
Sbjct:   268 VTVRLKHLTYLDDRPVFPKDRACAEAW 294




GO:0000922 "spindle pole" evidence=IEA
GO:0060271 "cilium morphogenesis" evidence=IMP
GO:0035085 "cilium axoneme" evidence=IDA
GO:0045502 "dynein binding" evidence=IMP
GO:0070286 "axonemal dynein complex assembly" evidence=IMP
GO:0060972 "left/right pattern formation" evidence=IMP
GO:0003356 "regulation of cilium beat frequency" evidence=IMP
GO:0036158 "outer dynein arm assembly" evidence=IMP
GO:0036159 "inner dynein arm assembly" evidence=IMP
GO:0003341 "cilium movement" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA;NAS
GO:0044458 "motile cilium assembly" evidence=IMP
GO:0001947 "heart looping" evidence=IMP
GO:0030324 "lung development" evidence=IMP
GO:0035469 "determination of pancreatic left/right asymmetry" evidence=IMP
GO:0071907 "determination of digestive tract left/right asymmetry" evidence=IMP
GO:0071910 "determination of liver left/right asymmetry" evidence=IMP
GO:0060287 "epithelial cilium movement involved in determination of left/right asymmetry" evidence=IC
GO:0005634 "nucleus" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
UNIPROTKB|F1MTA8 DNAAF1 "Dynein assembly factor 1, axonemal" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYS4 DNAAF1 "Dynein assembly factor 1, axonemal" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5U4 DNAAF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1915520 Dnaaf1 "dynein, axonemal assembly factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310542 Dnaaf1 "dynein, axonemal, assembly factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B6D5P1 Dnaaf1 "Dynein assembly factor 1, axonemal" [Peromyscus polionotus (taxid:42413)] Back     alignment and assigned GO terms
UNIPROTKB|B6D5P3 Dnaaf1 "Dynein assembly factor 1, axonemal" [Peromyscus leucopus (taxid:10041)] Back     alignment and assigned GO terms
UNIPROTKB|B6D5P6 Dnaaf1 "Dynein assembly factor 1, axonemal" [Peromyscus californicus (taxid:42520)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8P9 DNAAF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6AYH9DAAF1_RATNo assigned EC number0.58451.00.3270yesN/A
Q7PK92DAAF1_ANOGANo assigned EC number0.55981.00.2274yesN/A
Q3SYS4DAAF1_BOVINNo assigned EC number0.57971.00.3219yesN/A
Q9D2H9DAAF1_MOUSENo assigned EC number0.58451.00.3264yesN/A
Q8NEP3DAAF1_HUMANNo assigned EC number0.58451.00.2855yesN/A
Q7ZV84DAAF1_DANRENo assigned EC number0.55071.00.3729yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 46.1 bits (109), Expect = 5e-06
 Identities = 41/159 (25%), Positives = 73/159 (45%), Gaps = 9/159 (5%)

Query: 15  LYLTPSLNDVLYLHFKGYTVI-ENLEEYTGLKCLWLENNGISKIENLDAQ-TEMRSIYMH 72
           + L  S    L L       +   L     LK L L  N +S +  L +  + + ++ + 
Sbjct: 135 IGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLS 194

Query: 73  HNLVKVMENL-SHMQLLDTINLSHNFIEK-IENLSCLPVLRTLHLSHNRLKTIEDIEHLK 130
            N +  +      +  L+ ++LS+N I + + +LS L  L  L LS+N+L+ + +   + 
Sbjct: 195 GNKISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPES--IG 252

Query: 131 DCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNP 169
           +   L  +D+S+NQI     I   G++  LR L LS N 
Sbjct: 253 NLSNLETLDLSNNQISS---ISSLGSLTNLRELDLSGNS 288


Length = 394

>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.81
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.7
KOG4194|consensus 873 99.65
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.61
KOG0617|consensus264 99.58
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.57
KOG4194|consensus 873 99.56
KOG0617|consensus264 99.51
KOG0444|consensus 1255 99.44
KOG0444|consensus 1255 99.43
KOG1259|consensus490 99.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.33
KOG0472|consensus565 99.31
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.26
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.22
KOG0472|consensus 565 99.22
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.21
KOG1644|consensus233 99.2
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.18
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.17
KOG0532|consensus 722 99.15
KOG1259|consensus490 99.14
KOG0618|consensus 1081 99.12
KOG3207|consensus 505 99.11
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.09
KOG4237|consensus 498 99.07
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.06
KOG2982|consensus 418 99.02
KOG0618|consensus 1081 98.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
KOG2123|consensus 388 98.96
KOG0532|consensus 722 98.93
KOG4237|consensus 498 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.8
KOG3207|consensus 505 98.8
KOG1859|consensus 1096 98.8
KOG0531|consensus 414 98.79
KOG1859|consensus 1096 98.79
KOG0531|consensus 414 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG1909|consensus 382 98.75
KOG1909|consensus382 98.75
PLN03150623 hypothetical protein; Provisional 98.62
KOG4658|consensus 889 98.56
PLN03150623 hypothetical protein; Provisional 98.51
KOG1644|consensus233 98.44
KOG4579|consensus177 98.42
KOG3665|consensus 699 98.37
KOG2120|consensus419 98.36
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.36
KOG2739|consensus260 98.33
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
KOG2120|consensus419 98.27
KOG4579|consensus177 98.21
KOG3665|consensus 699 98.1
KOG2123|consensus 388 97.98
KOG2739|consensus260 97.93
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.93
KOG4658|consensus 889 97.76
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.72
KOG2982|consensus 418 97.26
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.99
PRK15386 426 type III secretion protein GogB; Provisional 96.91
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.64
PRK15386 426 type III secretion protein GogB; Provisional 96.43
KOG1947|consensus 482 96.22
KOG1947|consensus 482 95.8
KOG4341|consensus483 95.47
KOG3763|consensus 585 95.2
KOG3864|consensus221 95.07
KOG4308|consensus 478 94.9
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.1
KOG4341|consensus 483 92.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.58
KOG3864|consensus221 92.51
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.74
smart0037026 LRR Leucine-rich repeats, outliers. 89.68
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.68
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.9
KOG3763|consensus 585 86.53
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.42
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
Probab=99.81  E-value=1.5e-20  Score=133.83  Aligned_cols=155  Identities=35%  Similarity=0.528  Sum_probs=67.3

Q ss_pred             cCCccCccCCccCCCCCEEEeecCccccccCCc-cccCCcEEecCCCccccccCCCCCCCCcEEEcCCCccCCccccccC
Q psy10233         51 NNGISKIENLDAQTEMRSIYMHHNLVKVMENLS-HMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHL  129 (207)
Q Consensus        51 ~~~l~~~~~~~~l~~L~~L~l~~n~~~~~~~~~-~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l  129 (207)
                      .+.|+..+.+....++++|++++|.|+.++.+. .+.+|+.|++++|.++.+..+..++.|+.|++++|.|++++. ...
T Consensus         6 ~~~i~~~~~~~n~~~~~~L~L~~n~I~~Ie~L~~~l~~L~~L~Ls~N~I~~l~~l~~L~~L~~L~L~~N~I~~i~~-~l~   84 (175)
T PF14580_consen    6 ANMIEQIAQYNNPVKLRELNLRGNQISTIENLGATLDKLEVLDLSNNQITKLEGLPGLPRLKTLDLSNNRISSISE-GLD   84 (175)
T ss_dssp             ------------------------------S--TT-TT--EEE-TTS--S--TT----TT--EEE--SS---S-CH-HHH
T ss_pred             ccccccccccccccccccccccccccccccchhhhhcCCCEEECCCCCCccccCccChhhhhhcccCCCCCCcccc-chH
Confidence            344445555555566788888888887777766 477888888888888888777788888999999998887643 122


Q ss_pred             CCCCCccEEEccCCCCCChhhHHHhccCCCCcEEEcCCCccccchhhHHHHHHHhCCcceeccCcccCHHhhhhhhhC
Q psy10233        130 KDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEAW  207 (207)
Q Consensus       130 ~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~~~~L~~L~~~~~~~~~~~~~~~~  207 (207)
                      ..+++|++|++++|.|.+......++.+++|+.|++.+|+++ ..+.++..++..+|+|+.||...++..+|..|+.|
T Consensus        85 ~~lp~L~~L~L~~N~I~~l~~l~~L~~l~~L~~L~L~~NPv~-~~~~YR~~vi~~lP~Lk~LD~~~V~~~ER~~A~~~  161 (175)
T PF14580_consen   85 KNLPNLQELYLSNNKISDLNELEPLSSLPKLRVLSLEGNPVC-EKKNYRLFVIYKLPSLKVLDGQDVTEEERQEAEKL  161 (175)
T ss_dssp             HH-TT--EEE-TTS---SCCCCGGGGG-TT--EEE-TT-GGG-GSTTHHHHHHHH-TT-SEETTEETTS-B-------
T ss_pred             HhCCcCCEEECcCCcCCChHHhHHHHcCCCcceeeccCCccc-chhhHHHHHHHHcChhheeCCEEccHHHhcccccc
Confidence            457889999999999988665677789999999999999987 56888999999999999999999999998888765



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 4e-08
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 5e-08
2wqw_A286 Double-Disulfide Cross-Linked Crystal Dimer Of The 1e-05
1m9s_A 605 Crystal Structure Of Internalin B (Inlb), A Listeri 2e-05
2y5q_A362 Listeria Monocytogenes Inlb (Internalin B) Residues 3e-05
3rg1_A 612 Crystal Structure Of The Rp105MD-1 Complex Length = 3e-05
2wqx_A289 Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutan 3e-05
1h6t_A291 Internalin B: Crystal Structure Of Fused N-Terminal 4e-05
2uzx_A289 Structure Of The Human Receptor Tyrosine Kinase Met 5e-05
1otm_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 5e-05
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 6e-05
1otn_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-05
1oto_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-05
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 6e-05
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 6e-05
1d0b_A213 Internalin B Leucine Rich Repeat Domain Length = 21 6e-05
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-04
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-04
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-04
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-04
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-04
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 7e-04
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 9e-04
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 47/162 (29%), Positives = 81/162 (50%), Gaps = 14/162 (8%) Query: 54 ISKIENLDAQTEM----RSIYMHHNLVKVMENLSHMQLLDTINLSHNFIEKIENLSCLP- 108 I IE +DA + + + N ++ + +LS M+ L ++L N I+KIENL + Sbjct: 34 IPPIEKMDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVAD 93 Query: 109 VLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHN 168 L L +S+N++ ++ IE L + L ++ +S+N+I + I+ A+ +L L L+ N Sbjct: 94 TLEELWISYNQIASLSGIEKLVN---LRVLYMSNNKITNWGEIDKLAALDKLEDLLLAGN 150 Query: 169 PCVGKIK------NYRRMFINLCVNLRHLDDYPVFDKDRKCA 204 P K YR + NL+ LD PV +R+ A Sbjct: 151 PLYNDYKENNATSEYRIEVVKRLPNLKKLDGMPVDVDEREQA 192
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure
>pdb|2WQW|A Chain A, Double-Disulfide Cross-Linked Crystal Dimer Of The Listeria Monocytogenes Inlb Internalin Domain Length = 286 Back     alignment and structure
>pdb|1M9S|A Chain A, Crystal Structure Of Internalin B (Inlb), A Listeria Monocytogenes Virulence Protein Containing Sh3-Like Domains Length = 605 Back     alignment and structure
>pdb|2Y5Q|A Chain A, Listeria Monocytogenes Inlb (Internalin B) Residues 36-392 Length = 362 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|2WQX|A Chain A, Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutant Of The Listeria Monocytogenes Inlb Internalin Domain Length = 289 Back     alignment and structure
>pdb|1H6T|A Chain A, Internalin B: Crystal Structure Of Fused N-Terminal Domains Length = 291 Back     alignment and structure
>pdb|2UZX|A Chain A, Structure Of The Human Receptor Tyrosine Kinase Met In Complex With The Listeria Monocytogenes Invasion Protein Inlb: Crystal Form I Length = 289 Back     alignment and structure
>pdb|1OTM|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|1OTN|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTO|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure
>pdb|1D0B|A Chain A, Internalin B Leucine Rich Repeat Domain Length = 213 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-30
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-28
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-30
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-23
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-29
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-25
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-26
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-23
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-22
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-13
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
 Score =  144 bits (366), Expect = 5e-44
 Identities = 44/209 (21%), Positives = 82/209 (39%), Gaps = 21/209 (10%)

Query: 1   MTKASLRKICKDNKLYLTPSLNDVLYLHFKGYTVIE-NLEEYTGLKCLWLENNGISKIEN 59
             K ++R   +   +  T +    L+        ++  L      K L L  N I KI +
Sbjct: 6   TIKDAIRIFEERKSVVATEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKISS 65

Query: 60  LDAQTEMRSIYMHHNLVKVMENLSHM-QLLDTINLSHNFIEKIENLSCLPVLRTLHLSHN 118
           L     +R + +  NL+K +ENL  +   L+ + +S+N I  +  +  L  LR L++S+N
Sbjct: 66  LSGMENLRILSLGRNLIKKIENLDAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNN 125

Query: 119 RLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYR 178
           ++    +I+ L     L  + ++ N + ++                            YR
Sbjct: 126 KITNWGEIDKLAALDKLEDLLLAGNPLYNDYKENN-------------------ATSEYR 166

Query: 179 RMFINLCVNLRHLDDYPVFDKDRKCAEAW 207
              +    NL+ LD  PV   +R+ A   
Sbjct: 167 IEVVKRLPNLKKLDGMPVDVDEREQANVA 195


>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.8
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.79
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.76
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.76
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.73
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.73
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.73
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.72
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.72
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.71
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.71
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.71
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.71
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.71
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.71
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.7
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.7
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.69
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.69
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.68
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.68
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.68
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.68
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.67
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.67
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.65
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.64
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.64
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.63
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.63
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.62
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.52
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.52
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.49
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.49
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.13
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.13
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.81
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.37
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.02
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.39
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.09
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.04
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.57
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
Probab=99.86  E-value=8.7e-21  Score=144.80  Aligned_cols=167  Identities=19%  Similarity=0.259  Sum_probs=109.7

Q ss_pred             CCeEEeecCCCcCccCccCCCCCCEEEeecCCccCccCCccCCCCCEEEeecCccccccC--CccccCCcEEecCCCccc
Q psy10233         22 NDVLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMEN--LSHMQLLDTINLSHNFIE   99 (207)
Q Consensus        22 ~~~l~l~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~l~~L~~L~l~~n~~~~~~~--~~~~~~L~~L~l~~~~~~   99 (207)
                      .+.+.+..++++.++.++.+++|+.|++++|.+..++.+..+++|++|++++|.++.++.  +..+++|++|++++|.++
T Consensus        43 L~~L~l~~~~i~~~~~l~~l~~L~~L~l~~n~l~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~  122 (272)
T 3rfs_A           43 IDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQ  122 (272)
T ss_dssp             CCEEECTTSCCCCCTTGGGCTTCCEEECTTSCCCCCGGGTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCC
T ss_pred             eeeeeeCCCCcccccccccCCCCcEEECCCCCCCCchhhcCCCCCCEEECCCCccCccChhHhcCCcCCCEEECCCCcCC
Confidence            445666666666666677777777777777777766666677777777777777665533  566777777777777776


Q ss_pred             cccC--CCCCCCCcEEEcCCCccCCccccccCCCCCCccEEEccCCCCCChhhHHHhccCCCCcEEEcCCCccccchhhH
Q psy10233        100 KIEN--LSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNY  177 (207)
Q Consensus       100 ~~~~--~~~~~~L~~L~l~~n~i~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~  177 (207)
                      .++.  +..+++|+.|++++|.+++++. ..+..+++|+.|++++|.+++. .+..++.+++|+.|++++|.+.+..+. 
T Consensus       123 ~~~~~~~~~l~~L~~L~L~~n~l~~~~~-~~~~~l~~L~~L~l~~n~l~~~-~~~~~~~l~~L~~L~L~~N~l~~~~~~-  199 (272)
T 3rfs_A          123 SLPDGVFDKLTNLTYLNLAHNQLQSLPK-GVFDKLTNLTELDLSYNQLQSL-PEGVFDKLTQLKDLRLYQNQLKSVPDG-  199 (272)
T ss_dssp             CCCTTTTTTCTTCCEEECCSSCCCCCCT-TTTTTCTTCCEEECCSSCCCCC-CTTTTTTCTTCCEEECCSSCCSCCCTT-
T ss_pred             ccCHHHhccCCCCCEEECCCCccCccCH-HHhccCccCCEEECCCCCcCcc-CHHHhcCCccCCEEECCCCcCCccCHH-
Confidence            6532  5566777777777777666443 4456667777777777777654 244456667777777777776654443 


Q ss_pred             HHHHHHhCCcceeccCc
Q psy10233        178 RRMFINLCVNLRHLDDY  194 (207)
Q Consensus       178 ~~~~~~~~~~L~~L~~~  194 (207)
                         .+..+++|+.|++.
T Consensus       200 ---~~~~l~~L~~L~l~  213 (272)
T 3rfs_A          200 ---VFDRLTSLQYIWLH  213 (272)
T ss_dssp             ---TTTTCTTCCEEECC
T ss_pred             ---HHhCCcCCCEEEcc
Confidence               24566667666654



>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-13
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-11
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-11
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-10
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 68.9 bits (167), Expect = 1e-14
 Identities = 34/145 (23%), Positives = 64/145 (44%), Gaps = 6/145 (4%)

Query: 24  VLYLHFKGYTVIENLEEYTGLKCLWLENNGISKIENLDAQTEMRSIYMHHNLVKVMENLS 83
            L L     + +  L   T L  L L  N IS I  L   T + ++ ++ N ++ +  +S
Sbjct: 245 DLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPIS 304

Query: 84  HMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPLLSIVDVSHN 143
           +++ L  + L  N I  I  +S L  L+ L  ++N+   + D+  L +   ++ +   HN
Sbjct: 305 NLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNK---VSDVSSLANLTNINWLSAGHN 361

Query: 144 QIEDEEVIEVFGAMPELRVLTLSHN 168
           QI D   +     +  +  L L+  
Sbjct: 362 QISD---LTPLANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.86
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.72
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.62
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.44
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.22
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.13
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.12
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.08
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.95
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.89
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.14
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=6.8e-22  Score=137.94  Aligned_cols=149  Identities=25%  Similarity=0.334  Sum_probs=117.3

Q ss_pred             CccCCccCCCCCEEEeecCccccccCC-ccccCCcEEecCCCccccccCCCCCCCCcEEEcCCCccCCccccccCCCCCC
Q psy10233         56 KIENLDAQTEMRSIYMHHNLVKVMENL-SHMQLLDTINLSHNFIEKIENLSCLPVLRTLHLSHNRLKTIEDIEHLKDCPL  134 (207)
Q Consensus        56 ~~~~~~~l~~L~~L~l~~n~~~~~~~~-~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~~~~  134 (207)
                      ..+.+....++++|++++|.++.++.+ ..+++|+.|++++|.++.++.+..+++|+.|++++|.++.++. ..+..+++
T Consensus        10 ~~~~~~n~~~lr~L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~~~~~l~~L~~L~ls~N~i~~l~~-~~~~~l~~   88 (162)
T d1a9na_          10 QAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGE-GLDQALPD   88 (162)
T ss_dssp             TSCEEECTTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEECCCCCCSSCCEEECCSSCCCEECS-CHHHHCTT
T ss_pred             hhHhccCcCcCcEEECCCCCCCccCccccccccCCEEECCCCCCCccCCcccCcchhhhhcccccccCCCc-cccccccc
Confidence            334455566677777777777666553 4577788888888887777777778888888888888877544 34566888


Q ss_pred             ccEEEccCCCCCChhhHHHhccCCCCcEEEcCCCccccchhhHHHHHHHhCCcceeccCcccCHHhhhhhhh
Q psy10233        135 LSIVDVSHNQIEDEEVIEVFGAMPELRVLTLSHNPCVGKIKNYRRMFINLCVNLRHLDDYPVFDKDRKCAEA  206 (207)
Q Consensus       135 L~~L~l~~n~l~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~~~~L~~L~~~~~~~~~~~~~~~  206 (207)
                      |+.|++++|.+.+.+....+..+++|+.+++++|++. ..+.++...+..+++|++||...++..+|..|+.
T Consensus        89 L~~L~L~~N~i~~~~~l~~l~~l~~L~~L~l~~N~i~-~~~~~r~~~i~~lp~L~~LD~~~i~~~er~~A~~  159 (162)
T d1a9na_          89 LTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVT-NKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEK  159 (162)
T ss_dssp             CCEEECCSCCCCCGGGGGGGGGCTTCCEEECCSSGGG-GSTTHHHHHHHHCTTCSEETTEECCHHHHHHHHH
T ss_pred             cccceeccccccccccccccccccccchhhcCCCccc-cccchHHHHHHHCCCcCeeCCCCCCHHHHHHHHH
Confidence            9999999999988644456788999999999999986 6677666678999999999999999999988875



>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure