Diaphorina citri psyllid: psy1026


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MEETKVIYHIDDEETPYLVKLPVSPDKVTLADFKNVLNRPNFKFFFKSMDDDFGVVKEEIIEDDAHLPCFNGRVVSWQYNVPKEETPASSKTQTSRLVPYFFLLFHH
cccEEEEEEEccccccEEEEEccccccccHHHHHHHHcccccEEEEEcccccccccEEEECcccccccccccEEEEEEEEcccccccccccccccccccEEEEEEcc
**ETKVIYHIDDEETPYLVKLPVSPDKVTLADFKNVLNRPNFKFFFKSMDDDFGVVKEEIIEDDAHLPCFNGRVVSWQYNV**************RLVPYFFLLFHH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEETKVIYHIDDEETPYLVKLPVSPDKVTLADFKNVLNRPNFKFFFKSMDDDFGVVKEEIIEDDAHLPCFNGRVVSWQYNVPKEETPASSKTQTSRLVPYFFLLFHH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Segment polarity protein dishevelled homolog DVL-1 Participates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes. Required for LEF1 activation upon WNT1 and WNT3A signaling. DVL1 and PAK1 form a ternary complex with MUSK which is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ).confidentP51141
Segment polarity protein dishevelled Required to establish coherent arrays of polarized cells and segments in embryos. Plays a role in wingless (wg) signaling, possibly through the reception of the wg signal by target cells and subsequent redistribution of arm protein in response to that signal in embryos. This signal seems to be required to establish planar cell polarity and identity.confidentP51140
Segment polarity protein dishevelled homolog DVL-3 May play a role in the signal transduction pathway mediated by multiple Wnt genes (By similarity). Required in ciliogenesis for the docking of basal bodies to the apical plasma membrane.confidentB1WAP7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0003151 [BP]outflow tract morphogenesisprobableGO:0032502, GO:0044767, GO:0009887, GO:0032501, GO:0044707, GO:0007507, GO:0048513, GO:0048856, GO:0003007, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0032091 [BP]negative regulation of protein bindingprobableGO:0051098, GO:0051100, GO:0008150, GO:0065007, GO:0044092, GO:0043393, GO:0065009
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0060029 [BP]convergent extension involved in organogenesisprobableGO:0032502, GO:0002009, GO:0048856, GO:0060026, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0030031 [BP]cell projection assemblyprobableGO:0022607, GO:0030030, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0006469 [BP]negative regulation of protein kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0048675 [BP]axon extensionprobableGO:0032502, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0090179 [BP]planar cell polarity pathway involved in neural tube closureprobableGO:0090178, GO:0051239, GO:0022603, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0065007, GO:0050793, GO:0009987, GO:0050794, GO:0060071, GO:0044763, GO:0045995, GO:0007154, GO:0035567, GO:0044700, GO:0090175, GO:0050896, GO:0016055, GO:0051960, GO:2000026, GO:2000027, GO:0008150
GO:0044340 [BP]canonical Wnt receptor signaling pathway involved in regulation of cell proliferationprobableGO:0042127, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0016055, GO:0044763, GO:0050794, GO:0008150, GO:0060070, GO:0065007, GO:0007165, GO:0007166, GO:0007154, GO:0023052, GO:0050789, GO:0044699
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0070300 [MF]phosphatidic acid bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0005109 [MF]frizzled bindingprobableGO:0001664, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0045202 [CC]synapseprobableGO:0005575
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0046875 [MF]ephrin receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0003002 [BP]regionalizationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0035253 [CC]ciliary rootletprobableGO:0005856, GO:0005575, GO:0043228, GO:0043231, GO:0043232, GO:0031514, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422, GO:0044441
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0048013 [BP]ephrin receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0090103 [BP]cochlea morphogenesisprobableGO:0032502, GO:0048562, GO:0048568, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0090102, GO:0048513, GO:0043583, GO:0048598, GO:0009887, GO:0032501, GO:0044767, GO:0008150, GO:0042471, GO:0048839, GO:0042472, GO:0044707, GO:0007423, GO:0048856, GO:0048731
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0038031 [BP]non-canonical Wnt receptor signaling pathway via JNK cascadeprobableGO:0038030, GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0044699, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0035567
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0043507 [BP]positive regulation of JUN kinase activityprobableGO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0046328, GO:0043506, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0023051, GO:0060255, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0032872, GO:0032268, GO:0008150, GO:0042325, GO:0043410, GO:0042327, GO:0001932, GO:0080134, GO:0031401, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001843 [BP]neural tube closureprobableGO:0032502, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0021915, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0001841, GO:0060562, GO:0043009, GO:0048646, GO:0048598, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0060606, GO:0008150, GO:0035295, GO:0001838, GO:0014020, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048731
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0008013 [MF]beta-catenin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048668 [BP]collateral sproutingprobableGO:0032502, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0031329 [BP]regulation of cellular catabolic processprobableGO:0009894, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0030136 [CC]clathrin-coated vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PZ8, chain A
Confidence level:very confident
Coverage over the Query: 3-81
View the alignment between query and template
View the model in PyMOL