Diaphorina citri psyllid: psy10286

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------75

MDPLKHPSLEPNPDTSTVDYIRNLKMSKLIKRSVSPSFVTSTTSTMDECLVFQQLDLFSQGFPVMEEIRRQGKLCDVTIKVDDQSFTCHRIVLAATIPYFQAMFTSDMAESKQREITMQGIDAVIVLAATIPYFQAMFTSDMAESKQREITMQGIDAVAMEALINFVYSGRVTIHSQNVQSLMVVASFLQMQKVADACADFLKKRFHPNNVLDYYVLFSCRAMEALINFAYSGRVTIHSQNVQSLMVVASFLQMQKVADACADFLKKRFHPNNVLGIRQFADTLNCLQLSEAADKYVQQYFHEVSMSDEFIGLGVNEVNDIVKRSELHLMSEEQVFEAVMRWVKHNASERAPSLPRLLAAVRLPLLSPHYLADRVATEALIRSSHECRDLVDEARDFHLMPERRFLLAGEKTTPRRCNYVMGHIFAVGGLTKAGDSLSTVEVFDPLVGRWQMAEEETLSNAVISTKSCLTKAGDSLSTVEVFDPLVGRWQMAEAMSMLRSRVGVAVMKNRLYAFGGYNGSERLSTVEEFDPVRRVWNKVSPMCFKRSAVGAAALNDKLYVCGGYDGVSSLNTVECYEPDKDQWRIVKSMQKHRSAGGVIAFDSYVYALGGHDGLSIFDSVERYDPKTDEWTSVKPMLTKRCRLGVAALNNKIYVCGGYDGAIFLQSVEMYDPITDEWKMIASMNVMRSRVALVANMGKLWAIGGYDGVSNLPTVEVYDPSTDSWAFVAPMCAHEGGVGVGVIPICNPD

ccccccccccccccccccHHHHHccccHHHcccccccccccccccccccEEEEcccHHHHHHHHHHHHHHccccccEEEEEccCEEEHHHHHHHcccHHHHHHHcccHHHHHHHHHHHcccHHHHHHHcccccHHHccccccccccccEEEEccccHHHHHHHHHHHHcccEEEEEccEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccEEEccccHHHHHHHHHEEcccEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHccccccccHHHHHHHccccHHHHccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccccccccEEEEEccccccccccccccccEEEEEcccEEECccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEccccccccccEEEEEcccccCEEEccccccccccEEEEEEccEEEEEccccccccccEEEEECcccccEEEccccccccccEEEEEEccEEEEEEcccccccccEEEEECcccccEEEEcccccccccEEEEEEccEEEEEccccccccccEEEEEEccccEEEEEcccccccccEEEEEEccEEEEEccccccccccEEEEECcccccEEEccccccccccEEEEEEcccccc

************************************************CLVFQQLDLFSQGFPVMEEIRRQGKLCDVTIKVDDQSFTCHRIVLAATIPYFQAMFTSDMA**********GIDAVIVLAATIPYFQAMFTSDMAESKQREITMQGIDAVAMEALINFVYSGRVTIHSQNVQSLMVVASFLQMQKVADACADFLKKRFHPNNVLDYYVLFSCRAMEALINFAYSGRVTIHSQNVQSLMVVASFLQMQKVADACADFLKKRFHPNNVLGIRQFADTLNCLQLSEAADKYVQQYFHEVSMSDEFIGLGVNEVNDIVKRSELHLMSEEQVFEAVMRWVKHNASERAPSLPRLLAAVRLPLLSPHYLADRVATEALIRSSHECRDLVDEARDFHLMPERRFLLAGEKTTPRRCNYVMGHIFAVGGLTKAGDSLSTVEVFDPLVGRWQMAEEETLSNAVISTKSCLTKAGDSLSTVEVFDPLVGRWQMAEAMSMLRSRVGVAVMKNRLYAFGGYNGSERLSTVEEFDPVRRVWNKVSPMCFKRSAVGAAALNDKLYVCGGYDGVSSLNTVECYEPDKDQWRIVKSMQKHRSAGGVIAFDSYVYALGGHDGLSIFDSVERYDPKTDEWTSVKPMLTKRCRLGVAALNNKIYVCGGYDGAIFLQSVEMYDPITDEWKMIASMNVMRSRVALVANMGKLWAIGGYDGVSNLPTVEVYDPSTDSWAFVAPMCAHEGGVGVGVIPICNP*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Kelch-like protein 18		confident	O94889

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031463 [CC]	Cul3-RING ubiquitin ligase complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0016605 [CC]	PML body	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0006888 [BP]	ER to Golgi vesicle-mediated transport	probable	GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0004842 [MF]	ubiquitin-protein ligase activity	probable	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0051015 [MF]	actin filament binding	probable	GO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005913 [CC]	cell-cell adherens junction	probable	GO:0005575, GO:0030054, GO:0070161, GO:0005912, GO:0005911
GO:0030036 [BP]	actin cytoskeleton organization	probable	GO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0019964 [MF]	interferon-gamma binding	probable	GO:0019955, GO:0003674, GO:0005515, GO:0019961, GO:0005488
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005925 [CC]	focal adhesion	probable	GO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0009887 [BP]	organ morphogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0010499 [BP]	proteasomal ubiquitin-independent protein catabolic process	probable	GO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0010498, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0044238, GO:0009057
GO:0006513 [BP]	protein monoubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0014069 [CC]	postsynaptic density	probable	GO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048468 [BP]	cell development	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0044700 [BP]	single organism signaling	probable	GO:0008150, GO:0023052, GO:0044699
GO:0043161 [BP]	proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0051259 [BP]	protein oligomerization	probable	GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0030496 [CC]	midbody	probable	GO:0005575, GO:0044464, GO:0005623
GO:0015629 [CC]	actin cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032839 [CC]	dendrite cytoplasm	probable	GO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0032947 [MF]	protein complex scaffold	probable	GO:0003674, GO:0005488, GO:0005515, GO:0005198
GO:0030134 [CC]	ER to Golgi transport vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0030133, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0016044 [BP]	cellular membrane organization	probable	GO:0009987, GO:0016043, GO:0061024, GO:0008150, GO:0071840, GO:0044763, GO:0044699
GO:0071353 [BP]	cellular response to interleukin-4	probable	GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0070670, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0060429 [BP]	epithelium development	probable	GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0007154 [BP]	cell communication	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0007399 [BP]	nervous system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XN4, chain A
Confidence level:very confident
Coverage over the Query: 421-432,474-744
View the alignment between query and template
View the model in PyMOL

Template: 2XN4, chain A
Confidence level:very confident
Coverage over the Query: 439-697
View the alignment between query and template
View the model in PyMOL

Template: 2IF5, chain A
Confidence level:very confident
Coverage over the Query: 52-118,153-203
View the alignment between query and template
View the model in PyMOL

Template: 3I3N, chain A
Confidence level:very confident
Coverage over the Query: 49-122,151-211,275-402
View the alignment between query and template
View the model in PyMOL

Template: 2Q81, chain A
Confidence level:very confident
Coverage over the Query: 218-266
View the alignment between query and template
View the model in PyMOL

Template: 3I3N, chain A
Confidence level:confident
Coverage over the Query: 124-160,219-270
View the alignment between query and template
View the model in PyMOL