Diaphorina citri psyllid: psy10293

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MWADTLLIVFISVCTALLSEGLTWLLVYRTEKYQKLKTEIEKQMEKKKEAIESTLLDKNVKKKIEREEERLKNNNKDLTMVKMKSMFAIGFAFTALLSMFNTIFDGKIVAKLPFTPISWVQGLSHRNLSGEDYTDCSFIFLYILCTMSIRQNIQKMLGFAPSRTAAKQGGGMFGTQPKP
ccHHHHHHHHHHHHHHHHHHHHHHHEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCEEEEccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccccc
MWADTLLIVFISVCTALLSEGLTWLLVYRTEKYQKL*****************************************LTMVKMKSMFAIGFAFTALLSMFNTIFDGKIVAKLPFTPISWVQGLSHRNLSGEDYTDCSFIFLYILCTMSIRQNIQKMLGF********************
xxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWADTLLIVFISVCTALLSEGLTWLLVYRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSMFAIGFAFTALLSMFNTIFDGKIVAKLPFTPISWVQGLSHRNLSGEDYTDCSFIFLYILCTMSIRQNIQKMLGFAPSRTAAKQGGGMFGTQPKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane and coiled-coil domain-containing protein 1 very confidentQ3T0N3
Transmembrane and coiled-coil domains protein 1 very confidentC5HGF3
Transmembrane and coiled-coil domain-containing protein 1 very confidentQ9UM00

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055120 [CC]striated muscle dense bodyconfidentGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0071688 [BP]striated muscle myosin thick filament assemblyprobableGO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0051146, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0034622, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030154, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0044763, GO:0009987, GO:0042692
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003674 [MF]molecular_functionprobable

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HD7, chain A
Confidence level:probable
Coverage over the Query: 29-49
View the alignment between query and template
View the model in PyMOL