Diaphorina citri psyllid: psy10296


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MADQLCGYLFLKASGVNTEAIFPSANIARALATIFSTNVRGFEAGSMGAVNGMKPNGDRDRSAIQSEEVWTGVTYLLSAAMLYEGNVDEAWTTAGGLYRRLREDRVSGCETAPEGV
ccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccc
MADQLCGYLFLKASGVNTEAIFPSANIARALATIFSTNVRGFEAGSMGAVNGMKPNGDRDRSAIQSEEVWTGVTYLLSAAMLYEGNVDEAWTTAGGLYRRLREDRVSGCETAPE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADQLCGYLFLKASGVNTEAIFPSANIARALATIFSTNVRGFEAGSMGAVNGMKPNGDRDRSAIQSEEVWTGVTYLLSAAMLYEGNVDEAWTTAGGLYRRLREDRVSGCETAPEGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Non-lysosomal glucosylceramidase Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.confidentQ5M868
Non-lysosomal glucosylceramidase Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.confidentQ9HCG7
Non-lysosomal glucosylceramidase Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.confidentQ69ZF3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3c68, chain Aprobable Alignment | Template Structure