Diaphorina citri psyllid: psy10312


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MGSRFRFPLEFLGANCCFIFTGTELWEANLRNGGQPPPQVAQKTPWGHTPATNIGGTWGEDDEGESIPLETGR
cccccccccccccccCCcccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccc
****FRFPLEFLGANCCFIFTGTELWEANL*********************TNIGGTWG**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSRFRFPLEFLGANCCFIFTGTELWEANLRNGGQPPPQVAQKTPWGHTPATNIGGTWGEDDEGESIPLETGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein Gawky Required for gene silencing mediated by micro-RNAs (miRNAs). Silences both polyadenylated and deadenylated mRNAs. Required for miRNA-mediated translational repression and mRNA decay. Not required for miRNA target recognition. Necessary to initiate but not to maintain silencing. Promotes mRNA deadenylation through the recruitment of the CCR4-NOT and PAN complexes and promotes decapping by the DCP1-DCP2 complex. Dissociates from silenced mRNAs after deadenylation. Required for completion of nuclear divisions during early embryonic development.confidentQ8SY33

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001700 [BP]embryonic development via the syncytial blastodermprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted