Diaphorina citri psyllid: psy10316

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MKQALRSLIQYHGFTGLWKGLMPTLLRDVPFSAIYWVSYEQLKASYIRRHQYSKQPSLVHNFLFGSLAGSVAALVTTPFDIVKTLRQIDVAENEIMKSPPTRSQSTKTILNQLLTSKGYRALFTGKHSDGHEGFAGPSSPPSQSYYDPCSSGAGTGAKPSPSEEDGNWPISSPKDLNFPETIPEESSSVEEEHVVSLAPRLIKVAPSCAIMITSYELGKRYFVSKNTATLQELMREQESRELNRSMGDEQVDPL
cHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccCEEccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccc
*KQALRSLIQYHGFTGLWKGLMPTLLRDVPFSAIYWVSYEQLKASYIRRHQYSKQPSLVHNFLFGSLAGSVAALVTTPFDIVKTLRQIDVA************QSTKTILNQLLTSKGYRALFTGKHSDGHEGFAGPSSPPSQSYYDPCSSGAGTGAKPSPSEEDGNWPISSPKDLNF*ETIPEESSSVEEEHVVSLAPRLIKVAPSCAIMITSYELGKRYFVSKNT***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQALRSLIQYHGFTGLWKGLMPTLLRDVPFSAIYWVSYEQLKASYIRRHQYSKQPSLVHNFLFGSLAGSVAALVTTPFDIVKTLRQIDVAENEIMKSPPTRSQSTKTILNQLLTSKGYRALFTGKHSDGHEGFAGPSSPPSQSYYDPCSSGAGTGAKPSPSEEDGNWPISSPKDLNFPETIPEESSSVEEEHVVSLAPRLIKVAPSCAIMITSYELGKRYFVSKNTATLQELMREQESRELNRSMGDEQVDPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0071702 [BP]organic substance transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0005215 [MF]transporter activityprobableGO:0003674
GO:0006811 [BP]ion transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0071705 [BP]nitrogen compound transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 2-224
View the alignment between query and template
View the model in PyMOL