Diaphorina citri psyllid: psy10331

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MQNFYQTFAKRMENHKLYADVSAQDRELLLDYVEKYSMISLYPLLFCPPFTSDEDQDLEIQERIRQLKWVNAKHLDCGIEETNATVRDLVYNSMTKLLEMDSVRAPQDKLACVVACCRDIFLLLQSSVGPASADEFLPALIFLVLKMNPARLKSNIHFVTRFCNANRLMSGEAGYFFTNLVSI
cHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHHHHHHHcHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHcccc
MQNFYQTFAKRMENHKLYADVSAQDRELLLDYVEKYSMISLYPLLFCPPFTSDEDQDLEIQERIRQLKWVNAKHLDCGIEETNATVRDLVYNSMTKLLEMDSVRAPQDKLACVVACCRDIFLLLQSSVGPASADEFLPALIFLVLKMNPARLKSNIHFVTRFCNANRLMSGEAGYFFTNLVSI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNFYQTFAKRMENHKLYADVSAQDRELLLDYVEKYSMISLYPLLFCPPFTSDEDQDLEIQERIRQLKWVNAKHLDCGIEETNATVRDLVYNSMTKLLEMDSVRAPQDKLACVVACCRDIFLLLQSSVGPASADEFLPALIFLVLKMNPARLKSNIHFVTRFCNANRLMSGEAGYFFTNLVSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031398 [BP]positive regulation of protein ubiquitinationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0017112 [MF]Rab guanyl-nucleotide exchange factor activityprobableGO:0005088, GO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OT3, chain A
Confidence level:very confident
Coverage over the Query: 1-183
View the alignment between query and template
View the model in PyMOL