Diaphorina citri psyllid: psy10344

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19

MLKKYKKARSELKKRSTDTLRLQKKVGRKGVVGRNADLQKALQEVNERKAILEEAEKKALRAALIEERSRYCVFVTFLKPVVDEEVAMLSELSHLQEVMVQLEKHTSDPYSLPPASEQVMADMKGSDTTWLLPSPTSSPGSLGSRKSSMCSISSINSSSSGSSKSHHSPSHNYWNRSIHQLKISWEIQN

cHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccc

*******************************************EVNERKAILEEAEKKALRAALIEERSRYCVFVTFLKPVVDEEVAMLSELSHLQEVMVQLEKHTSDPYSLPPASEQVMADM******************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLKKYKKARSELKKRSTDTLRLQKKVGRKGVVGRxxxxxxxxxxxxxxxxxxxxxxxxxxxxALIEERSRYCVFVTFLKPVVDEEVAMLSELSHLQEVMVQLEKHTSDPYSLPPASEQVMADMKGSDTTWLLPSPTSSPGSLGSRKSSMCSISSINSSSSGSSKSHHSPSHNYWNRSIHQLKISWEIQN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Metastasis suppressor protein 1	Inhibits the nucleation of actin filaments in vitro.	confident	Q8R1S4
Metastasis suppressor protein 1	May be related to cancer progression or tumor metastasis in a variety of organ sites, most likely through an interaction with the actin cytoskeleton.	confident	O43312

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D1L, chain A
Confidence level:very confident
Coverage over the Query: 2-118
View the alignment between query and template
View the model in PyMOL