Diaphorina citri psyllid: psy10356


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MRTRGHATVKGEGMLWQEQRVIYGPSVIYIVILEHKSIICAGYSAVMHIHCVAEEVNVKALICLIDKKTGEKSKTRPRFVKQDQIAIMRLEAAGVICLDQFKLFPQMGRFTLRDEGKTIAIGKVLKIVE
cccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEEEHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEccEEEEECcccccccccEEEEccccEEEEEEEEEEEc
**TRGHA*VKGEGMLWQEQRVIYGPSVIYIVILEHKSIICAGYSAVMHIHCVAEEVNVKALICLIDKKT********RFVKQDQIAIMRLEAAGVICLDQFKLFPQMGRFTLRDEGKTIAIGKVLKIVE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTRGHATVKGEGMLWQEQRVIYGPSVIYIVILEHKSIICAGYSAVMHIHCVAEEVNVKALICLIDKKTGEKSKTRPRFVKQDQIAIMRLEAAGVICLDQFKLFPQMGRFTLRDEGKTIAIGKVLKIVE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic peptide chain release factor GTP-binding subunit ERF3A Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ERF1. Involved in regulation of mammalian cell growth. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.confidentQ8R050
Eukaryotic peptide chain release factor GTP-binding subunit ERF3B Involved in translation termination in response to the termination codons UAA, UAG and UGA. May play a role as a potent stimulator of the release factor activity of ETF1. Exhibits GTPase activity, which is ribosome- and ETF1-dependent. May play a role in cell cycle progression. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.confidentQ5R4B3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006479 [BP]protein methylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0008213, GO:0071704, GO:0043412, GO:0036211, GO:0043414, GO:0044237, GO:0008152, GO:0008150, GO:0032259
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0003747 [MF]translation release factor activityprobableGO:0008079, GO:0097159, GO:0008135, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0005488
GO:0006415 [BP]translational terminationprobableGO:0043933, GO:0044249, GO:0034645, GO:0043241, GO:0044699, GO:0044267, GO:0032984, GO:0044260, GO:0016043, GO:0008150, GO:0071704, GO:0010467, GO:0071840, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0043624, GO:0044238, GO:0071822, GO:0019538, GO:0044237, GO:0043170, GO:0022411, GO:0006412
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000184 [BP]nuclear-transcribed mRNA catabolic process, nonsense-mediated decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E1Y, chain E
Confidence level:very confident
Coverage over the Query: 6-129
View the alignment between query and template
View the model in PyMOL