Diaphorina citri psyllid: psy10378


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MARYLDNFERGGISSMEAVVRLTVAELNALGITLVGHQKKIMNSIQAMRTQLSANLSEGFLV
ccccHHHHHHcccccHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccc
*ARYLDNFERGGISSMEAVVRLTVAELNALGITLVGHQKKIMNSI*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARYLDNFERGGISSMEAVVRLTVAELNALGITLVGHQKKIMNSIQAMRTQLSANLSEGFLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ephrin type-A receptor 7 Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 is a cognate/functional ligand for EPHA7 and their interaction regulates brain development modulating cell-cell adhesion and repulsion. Has a repellent activity on axons and is for instance involved in the guidance of corticothalamic axons and in the proper topographic mapping of retinal axons to the colliculus. May also regulate brain development through a caspase(CASP3)-dependent proapoptotic activity. Forward signaling may result in activation of components of the ERK signaling pathway including MAP2K1, MAP2K2, MAPK1 AND MAPK3 which are phosphorylated upon activation of EPHA7.confidentQ15375
Ephrin type-A receptor 7 Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 is a cognate/functional ligand for EPHA7 and their interaction regulates brain development modulating cell-cell adhesion and repulsion. Has a repellent activity on axons and is for instance involved in the guidance of corticothalamic axons and in the proper topographic mapping of retinal axons to the colliculus. May also regulate brain development through a caspase(CASP3)-dependent proapoptotic activity. Forward signaling may result in activation of components of the ERK signaling pathway including MAP2K1, MAP2K2, MAPK1 AND MAPK3 which are phosphorylated upon activation of EPHA7.confidentO42422
Ephrin type-A receptor 7 Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Among GPI-anchored ephrin-A ligands, EFNA5 is a cognate/functional ligand for EPHA7 and their interaction regulates brain development modulating cell-cell adhesion and repulsion. Has a repellent activity on axons and is for instance involved in the guidance of corticothalamic axons and in the proper topographic mapping of retinal axons to the colliculus. May also regulate brain development through a caspase(CASP3)-dependent proapoptotic activity. Forward signaling may result in activation of components of the ERK signaling pathway including MAP2K1, MAP2K2, MAPK1 AND MAPK3 which are phosphorylated upon activation of EPHA7.confidentP54759

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005004 [MF]GPI-linked ephrin receptor activityprobableGO:0004714, GO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0005003, GO:0060089, GO:0004888, GO:0016740, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0031952 [BP]regulation of protein autophosphorylationprobableGO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0001932, GO:0050789
GO:0032314 [BP]regulation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0048583, GO:0035020, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032319, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0043410 [BP]positive regulation of MAPK cascadeprobableGO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0032956 [BP]regulation of actin cytoskeleton organizationprobableGO:0033043, GO:0032970, GO:0051493, GO:0051128, GO:0065007, GO:0008150, GO:0050794, GO:0050789
GO:0021766 [BP]hippocampus developmentprobableGO:0032502, GO:0021537, GO:0032501, GO:0007420, GO:0044707, GO:0048856, GO:0007399, GO:0044767, GO:0021543, GO:0048513, GO:0030900, GO:0008150, GO:0021761, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0061178 [BP]regulation of insulin secretion involved in cellular response to glucose stimulusprobableGO:0090087, GO:0032879, GO:0060341, GO:0051046, GO:0051049, GO:0002791, GO:0048583, GO:0050796, GO:0032844, GO:0090276, GO:0046883, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789, GO:0050794
GO:0016322 [BP]neuron remodelingprobableGO:0032502, GO:0030154, GO:0048468, GO:0007569, GO:0010259, GO:0007275, GO:0044699, GO:0042551, GO:0048869, GO:0008150, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0022407 [BP]regulation of cell-cell adhesionprobableGO:0008150, GO:0030155, GO:0065007, GO:0050789, GO:0050794
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0031290 [BP]retinal ganglion cell axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0050730 [BP]regulation of peptidyl-tyrosine phosphorylationprobableGO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0001932, GO:0050789
GO:0050919 [BP]negative chemotaxisprobableGO:0040011, GO:0006935, GO:0009605, GO:0050896, GO:0042330, GO:0008150, GO:0042221
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0070372 [BP]regulation of ERK1 and ERK2 cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0008046 [MF]axon guidance receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0033628 [BP]regulation of cell adhesion mediated by integrinprobableGO:0008150, GO:0030155, GO:0065007, GO:0050789, GO:0050794
GO:0046875 [MF]ephrin receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0031589 [BP]cell-substrate adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0006929 [BP]substrate-dependent cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0016477, GO:0051179, GO:0044699
GO:0048013 [BP]ephrin receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005005 [MF]transmembrane-ephrin receptor activityprobableGO:0004714, GO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0005003, GO:0060089, GO:0004888, GO:0016740, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0043281 [BP]regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0010259, GO:0051336, GO:0050790, GO:0065009, GO:0019222, GO:0012501, GO:2000116, GO:0006915, GO:0050794, GO:0065007, GO:0052548, GO:0043067, GO:0009987, GO:0044763, GO:0052547, GO:0008150, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699
GO:0005791 [CC]rough endoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0045499 [MF]chemorepellent activityprobableGO:0003674
GO:0043552 [BP]positive regulation of phosphatidylinositol 3-kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0043549, GO:0065007, GO:0044093, GO:0048518, GO:0045834, GO:0065009, GO:0042325, GO:0090218, GO:0019216, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0043551, GO:0043550, GO:0051338
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EAO, chain A
Confidence level:very confident
Coverage over the Query: 1-60
View the alignment between query and template
View the model in PyMOL