Diaphorina citri psyllid: psy10386

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPKQLVCEGEKGGRRSPNSAPSASLSGSFIALLVAAADLVCIVF

cCCcccccccEEccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHHccccccccccccCEEccccccccccccCECcccccCECccccccccccccccccCEEccEEEEEEEEEEEEEEEc

MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKED**MSR**T*CTL*********IKLSDLPKQLVCEGE*******NSAPSASLSGSFIALLVAAADLVCIVF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPKQLVCEGEKGGRRSPNSAPSASLSGSFIALLVAAADLVCIVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007409 [BP]	axonogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0048513 [BP]	organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 2-91
View the alignment between query and template
View the model in PyMOL