Psyllid ID: psy10386


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPKQLVCEGEKGGRRSPNSAPSASLSGSFIALLVAAADLVCIVF
cEEcccccccEEccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHHccccccccccccEEEccccccccccccEEEcccccEEEccccccccccccccccEEEccEEEEEEEEEEEEEEEc
ccccccccEEEccccccHHcccccccEEEcccccccccccccccccccccEEEcccccccEEcccccccccccccccccHHHHHHHHHHHHHccccHHHHccccEEEccccccccccccccccccHcEcccccccccccccccccccccccEEEEEEEEEEEEEEc
mieiwggqLSSIFEKVAtsgglhnldSLVLAHnqlrtipprvfahlpllnsleldgnhihtvdpaafsglednplvctcdlmwykewstslgekedeqmsrkrtvctlgssnvhqreiklsdlpkqlvcegekggrrspnsapsaslSGSFIALLVAAADLVCIVF
MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTslgekedeqmsRKRTvctlgssnvhqreiklsdlpKQLVCEgekggrrspnsapsaSLSGSFIALLVAAADLVCIVF
MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPKQLVCEGEKGGRRSPNSAPSASLSGSFIALLVAAADLVCIVF
**EIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWST***********************************************************GSFIALLVAAADLVCIV*
MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKED**MSR**T*CTL*********IKLSDLPKQLVCEGEKGGRRSPNSAPSASLSGSFIALLVAAADLVCIVF
MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTS*************TVCTLGSSNVHQREIKLSDLPKQLVC****************SLSGSFIALLVAAADLVCIVF
MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPKQLVCEGE*******NSAPSASLSGSFIALLVAAADLVCIVF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPKQLVCEGEKGGRRSPNSAPSASLSGSFIALLVAAADLVCIVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q9R1B9 1521 Slit homolog 2 protein OS yes N/A 0.530 0.057 0.326 5e-08
O94813 1529 Slit homolog 2 protein OS yes N/A 0.530 0.057 0.326 5e-08
Q6GU68 428 Immunoglobulin superfamil no N/A 0.463 0.179 0.352 1e-06
A4IFA6 428 Immunoglobulin superfamil no N/A 0.463 0.179 0.352 1e-06
Q91044 827 NT-3 growth factor recept no N/A 0.734 0.147 0.286 1e-06
Q5NVQ6 428 Immunoglobulin superfamil yes N/A 0.463 0.179 0.363 2e-06
Q9WVB4 1523 Slit homolog 3 protein OS no N/A 0.463 0.050 0.372 2e-06
Q9Z1P4 907 Leucine-rich repeat-conta no N/A 0.409 0.074 0.428 2e-06
O75094 1523 Slit homolog 3 protein OS no N/A 0.463 0.050 0.372 3e-06
O88280 1523 Slit homolog 3 protein OS no N/A 0.463 0.050 0.372 3e-06
>sp|Q9R1B9|SLIT2_MOUSE Slit homolog 2 protein OS=Mus musculus GN=Slit2 PE=2 SV=2 Back     alignment and function desciption
 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 10/98 (10%)

Query: 1   MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIH 60
           +I++   ++S++  +  ++  +  L +L+L++N+LR IPPR F  L  L  L L GN I 
Sbjct: 773 LIDLSNNRISTLSNQSFSN--MTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDIS 830

Query: 61  TVDPAAFSGLE--------DNPLVCTCDLMWYKEWSTS 90
            V   AF+ L          NPL C C++ W  +W  S
Sbjct: 831 VVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKS 868




Thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tube and projection of axons to different regions. SLIT1 and SLIT2 seem to be essential for midline guidance in the forebrain by acting as repulsive signal preventing inappropriate midline crossing by axons projecting from the olfactory bulb. In spinal chord development, may play a role in guiding commissural axons once they reached the floor plate by modulating the response to netrin. In vitro, silences the attractive effect of NTN1 but not its growth-stimulatory effect and silencing requires the formation of a ROBO1-DCC complex. May be implicated in spinal chord midline post-crossing axon repulsion. In vitro, only commissural axons that crossed the midline responded to SLIT2. In the developing visual system, appears to function as repellent for retinal ganglion axons by providing a repulsion that directs these axons along their appropriate paths prior to, and after passage through, the optic chiasm. In vitro, collapses and repels retinal ganglion cell growth cones. Seems to play a role in branching and arborization of CNS sensory axons, and in neuronal cell migration. In vitro, Slit homolog 2 protein N-product, but not Slit homolog 2 protein C-product, repels olfactory bulb (OB) but not dorsal root ganglia (DRG) axons, induces OB growth cones collapse and induces branching of DRG axons. Seems to be involved in regulating leukocyte migration.
Mus musculus (taxid: 10090)
>sp|O94813|SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens GN=SLIT2 PE=1 SV=1 Back     alignment and function description
>sp|Q6GU68|ISLR_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein OS=Mus musculus GN=Islr PE=1 SV=1 Back     alignment and function description
>sp|A4IFA6|ISLR_BOVIN Immunoglobulin superfamily containing leucine-rich repeat protein OS=Bos taurus GN=ISLR PE=2 SV=1 Back     alignment and function description
>sp|Q91044|NTRK3_CHICK NT-3 growth factor receptor OS=Gallus gallus GN=NTRK3 PE=2 SV=2 Back     alignment and function description
>sp|Q5NVQ6|ISLR_PONAB Immunoglobulin superfamily containing leucine-rich repeat protein OS=Pongo abelii GN=ISLR PE=2 SV=1 Back     alignment and function description
>sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z1P4|LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus GN=Lgr5 PE=2 SV=2 Back     alignment and function description
>sp|O75094|SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens GN=SLIT3 PE=2 SV=3 Back     alignment and function description
>sp|O88280|SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus GN=Slit3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
48097668 484 PREDICTED: slit homolog 1 protein-like [ 0.933 0.320 0.329 4e-16
350403510 484 PREDICTED: slit homolog 1 protein-like [ 0.891 0.305 0.325 1e-15
340722936 484 PREDICTED: slit homolog 1 protein-like [ 0.891 0.305 0.325 1e-15
307174510 487 Leucine-rich repeats and immunoglobulin- 0.903 0.308 0.317 4e-15
307203547 488 Leucine-rich repeats and immunoglobulin- 0.891 0.303 0.335 6e-15
270013642 479 hypothetical protein TcasGA2_TC012268 [T 0.421 0.146 0.583 2e-14
91089843 468 PREDICTED: similar to slit protein [Trib 0.421 0.149 0.583 2e-14
332020020 495 Leucine-rich repeats and immunoglobulin- 0.777 0.260 0.323 4e-13
383863394 484 PREDICTED: slit homolog 1 protein-like [ 0.867 0.297 0.320 2e-12
193643421 490 PREDICTED: slit homolog 3 protein-like i 0.421 0.142 0.555 2e-12
>gi|48097668|ref|XP_393853.1| PREDICTED: slit homolog 1 protein-like [Apis mellifera] Back     alignment and taxonomy information
 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 90/170 (52%), Gaps = 15/170 (8%)

Query: 3   EIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHI--- 59
           ++    +SS+ E   T  G  ++  L L  N ++ +PP VF +L  L +L L  N I   
Sbjct: 320 DLKANNISSLSEDAFTGYG-DSITFLNLQKNLIKILPPVVFENLNSLETLNLQNNKIAHI 378

Query: 60  ------HTVDPAAFSGLEDNPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNV 113
                 + VD      + DNPL+C C+L WY  W  +L +K+DE+MSRK TVCT+ S N 
Sbjct: 379 SEEVTENIVDTLRHIDITDNPLICDCELRWYSTWLGNLRDKDDERMSRKHTVCTMSSEN- 437

Query: 114 HQREIKLSDLP-KQLVCEGEKGGRRSPNSAPSASLSGSFIALLVAAADLV 162
             RE  + ++P +++ C G+  GR S + A     + + + LL+ A  ++
Sbjct: 438 --REYSVQNIPLERMGCVGKNAGRTS-SIATCHVYTDTMLRLLIVAVAML 484




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350403510|ref|XP_003486822.1| PREDICTED: slit homolog 1 protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722936|ref|XP_003399855.1| PREDICTED: slit homolog 1 protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307174510|gb|EFN64972.1| Leucine-rich repeats and immunoglobulin-like domains protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307203547|gb|EFN82580.1| Leucine-rich repeats and immunoglobulin-like domains protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270013642|gb|EFA10090.1| hypothetical protein TcasGA2_TC012268 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91089843|ref|XP_970465.1| PREDICTED: similar to slit protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332020020|gb|EGI60471.1| Leucine-rich repeats and immunoglobulin-like domains protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383863394|ref|XP_003707166.1| PREDICTED: slit homolog 1 protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|193643421|ref|XP_001943456.1| PREDICTED: slit homolog 3 protein-like isoform 1 [Acyrthosiphon pisum] gi|328701463|ref|XP_003241608.1| PREDICTED: slit homolog 3 protein-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
FB|FBgn0033250470 CG14762 [Drosophila melanogast 0.421 0.148 0.513 6.9e-13
UNIPROTKB|Q7L0X0 811 TRIL "TLR4 interactor with leu 0.421 0.086 0.385 9.9e-09
UNIPROTKB|J9NZ68 1337 SLIT2 "Uncharacterized protein 0.728 0.090 0.294 2.9e-08
UNIPROTKB|F1P8A1 1530 SLIT2 "Uncharacterized protein 0.728 0.079 0.294 3.4e-08
MGI|MGI:1349645 428 Islr "immunoglobulin superfami 0.795 0.308 0.306 5.7e-08
MGI|MGI:1315205 1521 Slit2 "slit homolog 2 (Drosoph 0.728 0.079 0.287 7e-08
UNIPROTKB|O94813 1529 SLIT2 "Slit homolog 2 protein" 0.728 0.079 0.287 7.1e-08
UNIPROTKB|F1S5C4 1045 SLIT2 "Uncharacterized protein 0.728 0.115 0.280 7.4e-08
UNIPROTKB|F1MLJ7 1532 SLIT2 "Uncharacterized protein 0.728 0.078 0.287 9e-08
UNIPROTKB|O14498 428 ISLR "Immunoglobulin superfami 0.795 0.308 0.313 1.2e-07
FB|FBgn0033250 CG14762 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 178 (67.7 bits), Expect = 6.9e-13, P = 6.9e-13
 Identities = 37/72 (51%), Positives = 49/72 (68%)

Query:     2 IEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHT 61
             +EI   ++ +I E      GL +LDSL+LAHN + T+P  VF+HL LLNSLEL+GN I  
Sbjct:   231 LEIQENKIRTISE--GDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISV 288

Query:    62 VDPAAFSGLEDN 73
             +D  AF GLE+N
Sbjct:   289 IDKDAFKGLEEN 300


GO:0048812 "neuron projection morphogenesis" evidence=IMP
UNIPROTKB|Q7L0X0 TRIL "TLR4 interactor with leucine rich repeats" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ68 SLIT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P8A1 SLIT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1349645 Islr "immunoglobulin superfamily containing leucine-rich repeat" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1315205 Slit2 "slit homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O94813 SLIT2 "Slit homolog 2 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5C4 SLIT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MLJ7 SLIT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O14498 ISLR "Immunoglobulin superfamily containing leucine-rich repeat protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-04
smart0037024 smart00370, LRR, Leucine-rich repeats, outliers 0.001
smart0036924 smart00369, LRR_TYP, Leucine-rich repeats, typical 0.001
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 52.2 bits (126), Expect = 5e-10
 Identities = 23/47 (48%), Positives = 31/47 (65%)

Query: 24 NLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGL 70
          NL SL L++N+L  IP   F  LP L  L+L GN++ ++ P AFSGL
Sbjct: 1  NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNNLTSISPEAFSGL 47


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|197688 smart00370, LRR, Leucine-rich repeats, outliers Back     alignment and domain information
>gnl|CDD|197687 smart00369, LRR_TYP, Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
KOG4237|consensus498 99.84
KOG4194|consensus 873 99.71
KOG4237|consensus 498 99.56
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.35
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 99.24
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 98.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.73
PLN03150623 hypothetical protein; Provisional 98.68
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.59
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.59
KOG4194|consensus 873 98.57
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.52
PLN03150623 hypothetical protein; Provisional 98.5
KOG0444|consensus 1255 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.05
KOG0617|consensus264 97.99
KOG0617|consensus264 97.96
KOG0444|consensus 1255 97.94
KOG1259|consensus490 97.78
KOG1644|consensus233 97.75
KOG0618|consensus 1081 97.59
KOG0472|consensus565 97.55
KOG0618|consensus 1081 97.54
KOG0472|consensus 565 97.5
KOG1859|consensus 1096 97.43
KOG4579|consensus177 97.29
KOG1259|consensus490 97.14
KOG4579|consensus177 97.14
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.12
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.11
smart0037026 LRR Leucine-rich repeats, outliers. 97.09
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 97.09
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.94
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.93
KOG0531|consensus 414 96.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.85
smart0037026 LRR Leucine-rich repeats, outliers. 96.8
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.8
KOG0531|consensus 414 96.43
KOG1644|consensus233 96.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.4
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 96.36
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.06
KOG1859|consensus 1096 96.01
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 95.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.7
KOG0532|consensus 722 95.37
KOG0532|consensus 722 94.93
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 94.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 94.22
KOG2739|consensus260 94.14
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 93.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 93.77
KOG2123|consensus 388 93.71
KOG4658|consensus 889 93.37
KOG4658|consensus 889 93.05
PLN03210 1153 Resistant to P. syringae 6; Provisional 92.93
PF0146325 LRRCT: Leucine rich repeat C-terminal domain; Inte 92.68
KOG2123|consensus 388 91.83
KOG3207|consensus505 91.63
KOG0473|consensus 326 90.98
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 90.9
KOG3207|consensus 505 90.05
KOG0473|consensus326 88.69
KOG2982|consensus 418 88.69
KOG2739|consensus260 88.66
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 85.5
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.84
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.53
KOG3763|consensus 585 81.72
PRK15386 426 type III secretion protein GogB; Provisional 81.55
>KOG4237|consensus Back     alignment and domain information
Probab=99.84  E-value=1.8e-21  Score=149.33  Aligned_cols=124  Identities=28%  Similarity=0.483  Sum_probs=112.6

Q ss_pred             CEEecCCCCceeeCCccccCCCccCceeeccCCcCCccCccccCCCCCCCEEeccCCcccccCccccCCCC--------C
Q psy10386          1 MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLE--------D   72 (166)
Q Consensus         1 ~L~ls~N~l~~~~~~~~~f~~l~~L~~L~ls~N~l~~i~~~~f~~l~~L~~l~l~~N~l~~~~~~~~~~l~--------~   72 (166)
                      .|+|++|+|+.+.++  +|.++..+++|+|..|+|..+...+|.++..|+.|+|.+|+|+.+.+.+|+.+.        .
T Consensus       278 ~lnlsnN~i~~i~~~--aFe~~a~l~eL~L~~N~l~~v~~~~f~~ls~L~tL~L~~N~it~~~~~aF~~~~~l~~l~l~~  355 (498)
T KOG4237|consen  278 KLNLSNNKITRIEDG--AFEGAAELQELYLTRNKLEFVSSGMFQGLSGLKTLSLYDNQITTVAPGAFQTLFSLSTLNLLS  355 (498)
T ss_pred             EeccCCCccchhhhh--hhcchhhhhhhhcCcchHHHHHHHhhhccccceeeeecCCeeEEEecccccccceeeeeehcc
Confidence            378999999999999  999999999999999999999999999999999999999999999999999988        8


Q ss_pred             CCccccCCcHHHHHHHHhccCCcchhcccCCceecCCCCCCcccCccccCCCC-cccCCCCCCCC
Q psy10386         73 NPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPK-QLVCEGEKGGR  136 (166)
Q Consensus        73 Np~~C~C~l~~l~~~~~~~~~~~~~~~~~~~~~C~~p~~~~~~~~~~l~~~~~-~~~C~~~~~~~  136 (166)
                      |||.|+|.+.|+.+|+++...       .....|..|..   +++.+++++.. ++.|..+....
T Consensus       356 Np~~CnC~l~wl~~Wlr~~~~-------~~~~~Cq~p~~---~~~~~~~dv~~~~~~c~~~ee~~  410 (498)
T KOG4237|consen  356 NPFNCNCRLAWLGEWLRKKSV-------VGNPRCQSPGF---VRQIPISDVAFGDFRCGGPEELG  410 (498)
T ss_pred             CcccCccchHHHHHHHhhCCC-------CCCCCCCCCch---hccccchhccccccccCCccccC
Confidence            999999999999999998651       35589999999   99999999987 77887554433



>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF01463 LRRCT: Leucine rich repeat C-terminal domain; InterPro: IPR000483 Leucine-rich repeats (LRR, see IPR001611 from INTERPRO) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 5e-09
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-06
2xot_A 361 Crystal Structure Of Neuronal Leucine Rich Repeat P 1e-05
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 3e-05
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 1e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 1e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 1e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 1e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 1e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 1e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 1e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 1e-04
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 1e-04
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 5e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 7e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 8e-04
2ifg_A 347 Structure Of The Extracellular Segment Of Human Trk 8e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 9e-04
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Iteration: 1

Score = 57.0 bits (136), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 10/98 (10%) Query: 1 MIEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIH 60 +I++ ++S++ + + + L +L+L++N+LR IPPR F L L L L GN I Sbjct: 58 LIDLSNNRISTLSNQ--SFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDIS 115 Query: 61 TVDPAAFSGLE--------DNPLVCTCDLMWYKEWSTS 90 V AF+ L NPL C C++ W +W S Sbjct: 116 VVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKS 153
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|2IFG|A Chain A, Structure Of The Extracellular Segment Of Human Trka In Complex With Nerve Growth Factor Length = 347 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-15
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 9e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-10
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 7e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 9e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-04
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
 Score = 83.5 bits (207), Expect = 3e-20
 Identities = 30/118 (25%), Positives = 40/118 (33%), Gaps = 18/118 (15%)

Query: 21  GLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSG--------LED 72
           GLH+LD L+L  N++  + P  F  L  L +L L  N++  +   A +         L D
Sbjct: 175 GLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLND 234

Query: 73  NPLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDL-PKQLVC 129
           NP VC C       W         E        C   S         L  L    L  
Sbjct: 235 NPWVCDCRARPLWAWLQKFRGSSSE------VPC---SLPQRLAGRDLKRLAANDLQG 283


>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.79
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.76
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.76
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.71
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.7
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.67
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.51
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.44
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.41
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.39
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.37
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.27
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.22
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.19
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.03
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.02
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.01
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.0
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.0
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.94
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.88
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.88
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.84
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.8
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.8
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.8
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.79
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.78
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.78
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.78
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.78
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.77
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.76
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.75
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.75
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.74
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.74
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.73
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.73
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.72
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.72
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.71
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.63
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.62
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.62
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.61
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.48
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.46
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.44
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.44
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.42
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.4
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.37
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.32
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.3
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.3
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.25
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.1
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.01
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.98
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.86
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.85
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.78
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.71
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.66
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.65
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.64
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.54
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.5
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.35
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.23
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.2
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.98
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.97
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.66
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.62
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 96.6
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 96.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.33
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 96.08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 95.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.23
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 94.35
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 94.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.33
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 93.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 92.5
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 92.38
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 92.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 87.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 85.28
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 83.92
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.87  E-value=4.3e-22  Score=142.35  Aligned_cols=119  Identities=30%  Similarity=0.583  Sum_probs=105.0

Q ss_pred             EEecCCCCceeeCCccccCCCccCceeeccCCcCCccCccccCCCCCCCEEeccCCcccccCccccCCCC--------CC
Q psy10386          2 IEIWGGQLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLE--------DN   73 (166)
Q Consensus         2 L~ls~N~l~~~~~~~~~f~~l~~L~~L~ls~N~l~~i~~~~f~~l~~L~~l~l~~N~l~~~~~~~~~~l~--------~N   73 (166)
                      |++++|+|+.+++.  .|.++++|+.|+|++|+++.+++.+|.++++|+.|++++|+++.+++..|..+.        +|
T Consensus        59 L~Ls~N~i~~i~~~--~f~~l~~L~~L~Ls~N~l~~i~~~~f~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N  136 (193)
T 2wfh_A           59 IDLSNNRISTLSNQ--SFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGAN  136 (193)
T ss_dssp             EECCSSCCCCCCTT--TTTTCTTCCEEECCSSCCCBCCTTTTTTCTTCCEEECCSSCCCBCCTTTTTTCTTCCEEECCSS
T ss_pred             EECCCCcCCEeCHh--HccCCCCCCEEECCCCccCEeCHHHhCCCCCCCEEECCCCCCCeeChhhhhcCccccEEEeCCC
Confidence            78999999999998  899999999999999999999999999999999999999999999998888766        89


Q ss_pred             CccccCCcHHHHHHHHhccCCcchhcccCCceecCCCCCCcccCccccCCCC-cccCCC
Q psy10386         74 PLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIKLSDLPK-QLVCEG  131 (166)
Q Consensus        74 p~~C~C~l~~l~~~~~~~~~~~~~~~~~~~~~C~~p~~~~~~~~~~l~~~~~-~~~C~~  131 (166)
                      ||.|+|++.|+..|++....      ......|..|..   ++|+.+.+++. .+.|..
T Consensus       137 ~~~C~c~l~~l~~~~~~~~~------~~~~~~C~~P~~---l~g~~l~~~~~~~~~~~~  186 (193)
T 2wfh_A          137 PLYCDCNMQWLSDWVKSEYK------EPGIARCAGPGE---MADKLLLTTPSKKFTCAA  186 (193)
T ss_dssp             CEECSGGGHHHHHHHHHSSC------CCSCCBEEESGG---GTTCBTTTSCGGGCCC--
T ss_pred             CeecCCcCHHHHHHHHhccC------CCCCcCcCCchH---HCCCCcccCChHHeeehh
Confidence            99999999999999987432      235689999999   99999999997 666643



>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.0 bits (123), Expect = 3e-09
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 32  HNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFS-------GLEDNPLVCTCDLMWY 84
           +N L  +P  +   L  L++L L  N ++T+    F         L  NP +C C+++++
Sbjct: 157 NNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYF 216

Query: 85  KEW 87
           + W
Sbjct: 217 RRW 219


>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.21
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.03
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.0
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.92
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.9
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.89
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.89
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.46
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.33
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.31
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.29
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.15
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.07
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.04
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.99
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.97
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.83
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.83
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.6
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.7
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.08
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 93.61
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 91.8
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 81.92
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: High affinity nerve growth factor receptor, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=3.4e-22  Score=136.82  Aligned_cols=109  Identities=24%  Similarity=0.435  Sum_probs=96.3

Q ss_pred             EEecCC-CCceeeCCccccCCCccCceeeccCCcCCccCccccCCCCCCCEEeccCCcccccCccccCCCC-------CC
Q psy10386          2 IEIWGG-QLSSIFEKVATSGGLHNLDSLVLAHNQLRTIPPRVFAHLPLLNSLELDGNHIHTVDPAAFSGLE-------DN   73 (166)
Q Consensus         2 L~ls~N-~l~~~~~~~~~f~~l~~L~~L~ls~N~l~~i~~~~f~~l~~L~~l~l~~N~l~~~~~~~~~~l~-------~N   73 (166)
                      |++++| .|+.++++  +|.++++|+.|++++|+|+.+++++|.++++|+.|+|++|+|++++++.|+.++       +|
T Consensus        36 L~l~~n~~l~~i~~~--~f~~l~~L~~L~Ls~N~l~~i~~~~f~~l~~L~~L~Ls~N~l~~l~~~~~~~~~l~~L~L~~N  113 (156)
T d2ifga3          36 LYIENQQHLQHLELR--DLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGN  113 (156)
T ss_dssp             EECCSCSSCCEECGG--GSCSCCCCSEEECCSSCCCEECTTGGGSCSCCCEEECCSSCCSCCCSTTTCSCCCCEEECCSS
T ss_pred             eecCCCccccccCch--hhccccccCcceeeccccCCcccccccccccccceeccCCCCcccChhhhccccccccccCCC
Confidence            678766 59999999  999999999999999999999999999999999999999999999999998777       99


Q ss_pred             CccccCCcHHHHHHHHhccCCcchhcccCCceecCCCCCCcccCcc
Q psy10386         74 PLVCTCDLMWYKEWSTSLGEKEDEQMSRKRTVCTLGSSNVHQREIK  119 (166)
Q Consensus        74 p~~C~C~l~~l~~~~~~~~~~~~~~~~~~~~~C~~p~~~~~~~~~~  119 (166)
                      ||.|+|++.|+.+|++......    ..++..|..|..   ++|.+
T Consensus       114 p~~C~C~~~~l~~~~~~~~~~~----~~~~~~C~~p~~---l~~~p  152 (156)
T d2ifga3         114 PLHCSCALRWLQRWEEEGLGGV----PEQKLQCHGQGP---LAHMP  152 (156)
T ss_dssp             CCCCCGGGHHHHHHHHTTCSSC----GGGCCCCSSSSC---SSCCC
T ss_pred             cccCCchHHHHHHHHHhccCcc----CcCCcEECcChH---HCcCC
Confidence            9999999999999998643322    246799999988   66654



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure