Diaphorina citri psyllid: psy10421


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MSETEPFQSIGSKLVDRPIPGCKHLPFGSDEYWVCCVKHLTMQTHHQCGTCKMGPATDRTAVVDPRLRVYGIQGLRVIDASIMPVLPGGHTVAPTYMIGEKGADMIKEDWLPGYTPTFDF
ccccHHHHHcccCCcccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEccccccEEECccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccc
**ETEPFQSIGSKLVDRPIPGCKHLPFGSDEYWVCCVKHLTMQTHHQCGTCKMGPATDRTAVVDPRLRVYGIQGLRVIDASIMPVLPGGHTVAPTYMIGEKGADMIKEDWLPGYT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSETEPFQSIGSKLVDRPIPGCKHLPFGSDEYWVCCVKHLTMQTHHQCGTCKMGPATDRTAVVDPRLRVYGIQGLRVIDASIMPVLPGGHTVAPTYMIGEKGADMIKEDWLPGYTPTFDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized GMC-type oxidoreductase Mb1310 confidentP64264
Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 confidentP64263
Choline dehydrogenase Can catalyze the oxidation of choline to betaine aldehyde and betaine aldehyde to glycine betaine.confidentA7MFA8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016614 [MF]oxidoreductase activity, acting on CH-OH group of donorsprobableGO:0003824, GO:0003674, GO:0016491
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032502 [BP]developmental processprobableGO:0008150
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GPE, chain A
Confidence level:very confident
Coverage over the Query: 2-112
View the alignment between query and template
View the model in PyMOL