Diaphorina citri psyllid: psy10428


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MSEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEAASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEESNNSTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDISTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDIVQKL
cccccccccEEEEEEEccccccccCEEEccccccccEEEECccccHHHHcccccccEEEEEccEEcccccHHHHHHHHHcccccEEEEEEcccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHcc
*****TPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSS**************************************************************************************************************************************************************************************************YDIVQKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEAASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEESNNSTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDISTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDIVQKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0003674 [MF]molecular_functionprobable
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XKX, chain A
Confidence level:very confident
Coverage over the Query: 8-94
View the alignment between query and template
View the model in PyMOL
Template: 2KRG, chain A
Confidence level:confident
Coverage over the Query: 204-246
View the alignment between query and template
View the model in PyMOL
Template: 1SGH, chain B
Confidence level:confident
Coverage over the Query: 271-309
View the alignment between query and template
View the model in PyMOL
Template: 3TSW, chain B
Confidence level:probable
Coverage over the Query: 12-117
View the alignment between query and template
View the model in PyMOL