Psyllid ID: psy10428

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MSEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEAASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEESNNSTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDISTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDIVQKL
cccccccccEEEEEEEccccccccEEEEccccccccEEEEEccccHHHHHccccccEEEEEccEEcccccHHHHHHHHHcccccEEEEEEccccHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHcc
ccccccccccEEEEEEcccccEcccEEEccccccccEEEccccccHHHHcccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEcccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccEEcccccccccccccccEEEEEcccccHHHHcccccccEEEEEcccccHHHHHHHHHHcccccccccHHcHHHccccccHHHcccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHcc
MSEDKTPVVRLCHILkwtdfdgygfnlhgekgktgqyigkvdegspaeaaglkegdhiieVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASeeyfksnnitissslpdivhlrtpatsgnsnhvekpsseaaseeyfksnnitissslpdivhlrtpatsgnsnhvekpsseesnnstnqsltnntptpttntnnttnhenqnnlnLNMSAKELRAKLASrkkydpkkdyldikkkydistnqsltnntptpttntnnttnhenqnnlnLNMSAKELRAKLASrkkydpkkdyldikkKYDIVQKL
MSEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASeeyfksnnitissslpdiVHLRtpatsgnsnhvEKPSSEAASEEYFKSNNITISSSLPDIVHLRTPatsgnsnhvekpsseesnnstnqsltnntptpttNTNNTTNHENQNNLNLNMSAKELRAKLasrkkydpkkdyldikkkydistnqsltnntptpttntnnttnhenqnnlNLNMSAKELRAKLasrkkydpkkdyldikkkydivqkl
MSEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEAASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKpsseesnnstnqsltnntptpttntnnttnhenqnnlnlnMSAKELRAKLASRkkydpkkdyldikkkydIstnqsltnntptpttntnnttnhenqnnlnlnMSAKELRAKLASRkkydpkkdyldikkkydIVQKL
*******VVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKV**********LKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVH***************************************************************************************************************************************************************************************************
*****TP***LCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVA*****************************************************************************************************************************************************************************************************************YDIVQKL
MSEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVHLRTPAT*****************EYFKSNNITISSSLPDIVHLRTPA****************************PTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDISTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDIVQKL
*****TPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSS****************************************SSLPDIVHLRTPATSGNSNHVEKPSSEESNNSTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDISTNQSLTN**P*****************************************DYLDIKKKYDIVQKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEAASEEYFKSNNITISSSLPDIVHLRTPATSGNSNHVEKPSSEESNNSTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDISTNQSLTNNTPTPTTNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDPKKDYLDIKKKYDIVQKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query309 2.2.26 [Sep-21-2011]
Q8SQG9316 Na(+)/H(+) exchange regul yes N/A 0.317 0.310 0.52 1e-25
Q15599337 Na(+)/H(+) exchange regul yes N/A 0.317 0.290 0.51 2e-25
Q9JHL1337 Na(+)/H(+) exchange regul yes N/A 0.317 0.290 0.51 2e-24
Q920G2337 Na(+)/H(+) exchange regul yes N/A 0.317 0.290 0.5 1e-23
Q28619358 Na(+)/H(+) exchange regul yes N/A 0.346 0.298 0.491 1e-22
Q5ZM14333 Na(+)/H(+) exchange regul no N/A 0.330 0.306 0.495 1e-21
Q4R6G4358 Na(+)/H(+) exchange regul N/A N/A 0.346 0.298 0.473 1e-21
P70441355 Na(+)/H(+) exchange regul no N/A 0.346 0.301 0.473 1e-21
O14745358 Na(+)/H(+) exchange regul no N/A 0.346 0.298 0.473 2e-21
Q9JJ19356 Na(+)/H(+) exchange regul no N/A 0.394 0.342 0.437 2e-21
>sp|Q8SQG9|NHRF2_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Oryctolagus cuniculus GN=SLC9A3R2 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 10  RLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNE 69
           RLC +++     GYGF+LHGEKG+ GQ+I +V+ GSPAEAA L+ GD ++EVN VN+  E
Sbjct: 10  RLCRLVR--GEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGE 67

Query: 70  NHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSL 109
            H+QVVQRIKAV  ET+LLVVD  ++E  +   +T +  +
Sbjct: 68  THHQVVQRIKAVEGETRLLVVDKETDEELRRRQLTCTEDM 107
Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.
Oryctolagus cuniculus (taxid: 9986)
>sp|Q15599|NHRF2_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens GN=SLC9A3R2 PE=1 SV=2 Back     alignment and function description
>sp|Q9JHL1|NHRF2_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Mus musculus GN=Slc9a3r2 PE=1 SV=2 Back     alignment and function description
>sp|Q920G2|NHRF2_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Rattus norvegicus GN=Slc9a3r2 PE=1 SV=1 Back     alignment and function description
>sp|Q28619|NHRF1_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Oryctolagus cuniculus GN=SLC9A3R1 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZM14|NHRF1_CHICK Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Gallus gallus GN=SLC9A3R1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R6G4|NHRF1_MACFA Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Macaca fascicularis GN=SLC9A3R1 PE=2 SV=1 Back     alignment and function description
>sp|P70441|NHRF1_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Mus musculus GN=Slc9a3r1 PE=1 SV=3 Back     alignment and function description
>sp|O14745|NHRF1_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens GN=SLC9A3R1 PE=1 SV=4 Back     alignment and function description
>sp|Q9JJ19|NHRF1_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Rattus norvegicus GN=Slc9a3r1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
380026403258 PREDICTED: Na(+)/H(+) exchange regulator 0.757 0.906 0.498 7e-60
156549046243 PREDICTED: Na(+)/H(+) exchange regulator 0.766 0.975 0.504 9e-60
48129806260 PREDICTED: Na(+)/H(+) exchange regulator 0.770 0.915 0.494 1e-59
383852210263 PREDICTED: Na(+)/H(+) exchange regulator 0.724 0.851 0.441 8e-54
350413716256 PREDICTED: Na(+)/H(+) exchange regulator 0.773 0.933 0.487 1e-53
340710240256 PREDICTED: Na(+)/H(+) exchange regulator 0.773 0.933 0.487 1e-53
157134592289 hypothetical protein AaeL_AAEL013138 [Ae 0.847 0.906 0.387 9e-45
241407181226 PDZ domain-containing protein, putative 0.686 0.938 0.426 9e-44
427784047 465 hypothetical protein [Rhipicephalus pulc 0.760 0.505 0.374 1e-43
427784049 465 hypothetical protein [Rhipicephalus pulc 0.760 0.505 0.374 2e-43
>gi|380026403|ref|XP_003696941.1| PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like [Apis florea] Back     alignment and taxonomy information
 Score =  236 bits (603), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 162/253 (64%), Gaps = 19/253 (7%)

Query: 4   DKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNS 63
           DK P  RLCHI+KW DFDGYGFNLH EKGK GQ+IGKVD+GSP++AAGL++GD IIEVN 
Sbjct: 7   DKIPCARLCHIVKWDDFDGYGFNLHAEKGKNGQFIGKVDDGSPSQAAGLRQGDRIIEVNE 66

Query: 64  VNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISSSLPDIVHLRTPATSGN 123
           +NI NE H QVV+RIKA P+ETKLLVVD  ++EYF++NNI I  ++ ++  ++TP  + N
Sbjct: 67  INIANETHKQVVERIKAFPNETKLLVVDQEADEYFRANNIVIKGTMANVKVIKTPEKNPN 126

Query: 124 SNHVEKPSSEAASEEYFKSNNITISSSLPDIVH----------LRTPATSGNSNHVEKPS 173
           S+  E+ +   AS +     N   SS   D +H           RT   S N N  E   
Sbjct: 127 SSEQEELNGSNASTD----ENAQKSSGSNDTLHSESSTVSASATRTSTRSENDNENE-SE 181

Query: 174 SEESNNSTNQSLTNNTPTPT----TNTNNTTNHENQNNLNLNMSAKELRAKLASRKKYDP 229
            EE+      S+ N+T T      T   N T +E++  LNL MSAKELRA+LA RKKYDP
Sbjct: 182 REETGQENGNSIKNDTTTMAHVHGTGNGNVTGNESRQGLNLKMSAKELRAQLALRKKYDP 241

Query: 230 KKDYLDIKKKYDI 242
           KK+ +  K K+DI
Sbjct: 242 KKESIGFKDKFDI 254

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156549046|ref|XP_001607422.1| PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|48129806|ref|XP_396656.1| PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383852210|ref|XP_003701621.1| PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350413716|ref|XP_003490086.1| PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340710240|ref|XP_003393702.1| PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|157134592|ref|XP_001663319.1| hypothetical protein AaeL_AAEL013138 [Aedes aegypti] gi|108870417|gb|EAT34642.1| AAEL013138-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|241407181|ref|XP_002409814.1| PDZ domain-containing protein, putative [Ixodes scapularis] gi|215497531|gb|EEC07025.1| PDZ domain-containing protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|427784047|gb|JAA57475.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427784049|gb|JAA57476.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
FB|FBgn0010620296 Sip1 "SRY interacting protein 0.504 0.527 0.439 9.9e-31
UNIPROTKB|F1NQR2346 SLC9A3R2 "Uncharacterized prot 0.462 0.413 0.480 2.2e-27
UNIPROTKB|F1RFB4335 SLC9A3R2 "Uncharacterized prot 0.530 0.489 0.388 2e-24
UNIPROTKB|D3DU85326 SLC9A3R2 "Na(+)/H(+) exchange 0.504 0.478 0.391 8.7e-24
UNIPROTKB|Q15599337 SLC9A3R2 "Na(+)/H(+) exchange 0.504 0.462 0.391 8.7e-24
UNIPROTKB|G3N1L5382 SLC9A3R2 "Uncharacterized prot 0.504 0.408 0.403 8.7e-24
UNIPROTKB|Q8SQG9316 SLC9A3R2 "Na(+)/H(+) exchange 0.317 0.310 0.52 1.1e-23
MGI|MGI:1890662337 Slc9a3r2 "solute carrier famil 0.501 0.459 0.401 3.8e-23
RGD|620380337 Slc9a3r2 "solute carrier famil 0.501 0.459 0.395 7.8e-23
ZFIN|ZDB-GENE-031006-7386 slc9a3r1 "solute carrier famil 0.491 0.393 0.407 2.7e-22
FB|FBgn0010620 Sip1 "SRY interacting protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 306 (112.8 bits), Expect = 9.9e-31, Sum P(2) = 9.9e-31
 Identities = 73/166 (43%), Positives = 98/166 (59%)

Query:     8 VVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNIC 67
             V + CHI+K  DFDGYGFNLH EK K GQ+IGKVD  SPAEAAGLKEGD I+EVN V+I 
Sbjct:    19 VTKTCHIVKRPDFDGYGFNLHSEKVKPGQFIGKVDADSPAEAAGLKEGDRILEVNGVSIG 78

Query:    68 NENHNQVVQRIKAVPDETKLLVVDV---------ASEEYFKSN-NITISSSLPDIVHLRT 117
             +E H QVV RIKA+ +E +LL++DV         AS      N N + S +  +      
Sbjct:    79 SETHKQVVARIKAIANEVRLLLIDVDGKALEVKPASPPAAACNGNGSASQNGYEGTKQEM 138

Query:   118 PATSGNSNHVEKPSSEAASEEYFKSNNITISSSLPDIVHLRTPATS 163
             P  S N + +   S++ +S      +  T+++S  D+V    PA +
Sbjct:   139 PGASANISSISMVSTKRSSNASSIQSGSTMNASDLDVVDRGIPAVA 184
GO:0042048 "olfactory behavior" evidence=IMP
GO:0045177 "apical part of cell" evidence=IDA
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
UNIPROTKB|F1NQR2 SLC9A3R2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFB4 SLC9A3R2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|D3DU85 SLC9A3R2 "Na(+)/H(+) exchange regulatory cofactor NHE-RF2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15599 SLC9A3R2 "Na(+)/H(+) exchange regulatory cofactor NHE-RF2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3N1L5 SLC9A3R2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8SQG9 SLC9A3R2 "Na(+)/H(+) exchange regulatory cofactor NHE-RF2" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:1890662 Slc9a3r2 "solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620380 Slc9a3r2 "solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031006-7 slc9a3r1 "solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 3e-21
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 3e-19
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 5e-14
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 6e-12
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 8e-09
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 2e-07
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 1e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 6e-05
pfam1318081 pfam13180, PDZ_2, PDZ domain 4e-04
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 5e-04
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 8e-04
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 0.002
TIGR00225334 TIGR00225, prc, C-terminal peptidase (prc) 0.003
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 85.3 bits (212), Expect = 3e-21
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 9  VRLCHILKWTDFDGYGFNLHGEKG-KTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNIC 67
          VR   + K     G GF+L G K    G ++ +V+ G PAE  GL+ GD I+EVN V++ 
Sbjct: 1  VRTVTLRK-DPGGGLGFSLRGGKDSGGGIFVSRVEPGGPAERGGLRVGDRILEVNGVSVE 59

Query: 68 NENHNQVVQRIKAVPDETKLLVV 90
             H + V+ +K   DE  L V 
Sbjct: 60 GLTHEEAVELLKNSGDEVTLTVR 82

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 309
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.34
KOG3550|consensus207 99.25
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.03
KOG3551|consensus 506 99.02
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.98
KOG3209|consensus984 98.98
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.98
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.94
KOG3209|consensus984 98.9
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.8
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.75
KOG1892|consensus 1629 98.73
KOG3549|consensus 505 98.67
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.58
KOG3553|consensus124 98.53
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.47
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.42
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.4
PLN00049389 carboxyl-terminal processing protease; Provisional 98.38
KOG3552|consensus 1298 98.35
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.26
KOG3580|consensus 1027 98.25
KOG3606|consensus358 98.2
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.13
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.08
PRK10779449 zinc metallopeptidase RseP; Provisional 98.0
PRK10139455 serine endoprotease; Provisional 97.98
PRK10139455 serine endoprotease; Provisional 97.98
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.98
PRK10942473 serine endoprotease; Provisional 97.94
PRK10898353 serine endoprotease; Provisional 97.94
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.93
KOG3542|consensus 1283 97.93
KOG3605|consensus829 97.92
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.89
KOG3580|consensus 1027 97.87
KOG0609|consensus 542 97.84
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.84
PRK10942473 serine endoprotease; Provisional 97.79
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.78
PRK11186 667 carboxy-terminal protease; Provisional 97.77
KOG3651|consensus 429 97.74
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.68
KOG3571|consensus626 97.68
PRK10779449 zinc metallopeptidase RseP; Provisional 97.64
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.47
KOG0606|consensus 1205 97.31
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.31
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.84
KOG3938|consensus334 96.73
KOG3129|consensus231 96.71
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.66
KOG3605|consensus829 96.14
PRK09681276 putative type II secretion protein GspC; Provision 96.09
COG3975558 Predicted protease with the C-terminal PDZ domain 95.82
KOG3532|consensus 1051 95.49
KOG1320|consensus473 95.23
KOG1738|consensus 638 95.05
KOG4407|consensus 1973 95.03
COG3031275 PulC Type II secretory pathway, component PulC [In 94.3
KOG1421|consensus 955 94.18
PF1281278 PDZ_1: PDZ-like domain 93.39
COG3480342 SdrC Predicted secreted protein containing a PDZ d 90.31
COG0750375 Predicted membrane-associated Zn-dependent proteas 90.15
KOG3834|consensus462 89.5
PF0900741 EBP50_C-term: EBP50, C-terminal; InterPro: IPR0150 88.34
KOG3834|consensus 462 81.99
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information 
Probab=99.34  E-value=1e-11  Score=95.18  Aligned_cols=76  Identities=36%  Similarity=0.566  Sum_probs=67.4

Q ss_pred             EEEEeeCCCCcceeEEEeccCCC--CCeEEEEeCCCCHHHHcCCCCCCEEEEECCEEcCCCCHHHHHHHHHhCCCCeEE
Q psy10428         11 LCHILKWTDFDGYGFNLHGEKGK--TGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKL   87 (309)
Q Consensus        11 ~v~L~K~~~~~G~GFsl~ggk~~--~Gi~V~~V~pgSpA~~AGLq~GD~Il~VNG~~V~~~sh~dvv~~Lk~s~~~vvl   87 (309)
                      ++.|.|. ...+|||.+.++...  .+++|..|.++|+|+++||++||+|++|||+++.++++.+++.+++.+.+.+.+
T Consensus         1 ~v~l~k~-~~~~lG~~l~~~~~~~~~~~~V~~v~~~~~a~~~gl~~GD~Il~INg~~v~~~~~~~~~~~l~~~~~~v~L   78 (81)
T PF00595_consen    1 QVTLEKS-GNGPLGFTLRGGSDNDEKGVFVSSVVPGSPAERAGLKVGDRILEINGQSVRGMSHDEVVQLLKSASNPVTL   78 (81)
T ss_dssp             EEEEEES-TTSBSSEEEEEESTSSSEEEEEEEECTTSHHHHHTSSTTEEEEEETTEESTTSBHHHHHHHHHHSTSEEEE
T ss_pred             CEEEEeC-CCCCcCEEEEecCCCCcCCEEEEEEeCCChHHhcccchhhhhheeCCEeCCCCCHHHHHHHHHCCCCcEEE
Confidence            4678885 359999999998765  499999999999999999999999999999999999999999999999874433

PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated. PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....
>KOG3550|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PF09007 EBP50_C-term: EBP50, C-terminal; InterPro: IPR015098 This C-terminal domain allows interaction of EBP50 with FERM (four-point one ERM) domains, resulting in the activation of Ezrin-radixin-moesin (ERM), with subsequent cytoskeletal modulation and cellular growth control [] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
2ocs_A88 The Crystal Structure Of The First Pdz Domain Of Hu 2e-22
2krg_A216 Solution Structure Of Human Sodium HYDROGEN EXCHANG 1e-20
2kjd_A128 Solution Structure Of Extended Pdz2 Domain From Nhe 5e-20
1g9o_A91 First Pdz Domain Of The Human Na+H+ EXCHANGER REGUL 2e-19
1gq5_A91 Structural Determinants Of The Nherf Interaction Wi 4e-19
1i92_A91 Structural Basis Of The Nherf Pdz1-Cftr Interaction 6e-19
2jxo_A98 Structure Of The Second Pdz Domain Of Nherf-1 Lengt 8e-19
1gq4_A90 Structural Determinants Of The Nherf Interaction Wi 1e-18
2ozf_A92 The Crystal Structure Of The 2nd Pdz Domain Of The 3e-16
2he4_A90 The Crystal Structure Of The Second Pdz Domain Of H 8e-16
2eej_A96 Solution Structure Of Fourth Pdz Domain Of Pdz Doma 6e-11
3tmh_A87 Crystal Structure Of Dual-Specific A-Kinase Anchori 7e-11
2vsp_A91 Crystal Structure Of The Fourth Pdz Domain Of Pdz D 7e-11
4f8k_A109 Molecular Analysis Of The Interaction Between The P 4e-10
2edz_A114 Solution Structures Of The Pdz Domain Of Mus Muscul 4e-10
3ngh_A106 Molecular Analysis Of The Interaction Of The Hdl Re 4e-10
2d90_A102 Solution Structure Of The Third Pdz Domain Of Pdz D 7e-10
3r69_A89 Molecular Analysis Of The Interaction Of The Hdl-Re 2e-09
3r68_A95 Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Leng 2e-09
3qe1_A107 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 3e-08
3qdo_A109 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 4e-08
1q3o_A109 Crystal Structure Of The Shank Pdz-ligand Complex R 7e-08
3l4f_D132 Crystal Structure Of Betapix Coiled-Coil Domain And 7e-08
3qjm_A115 Structural Flexibility Of Shank Pdz Domain Is Impor 8e-08
2eei_A106 Solution Structure Of Second Pdz Domain Of Pdz Doma 9e-08
3qgl_A101 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 2e-07
2v90_A96 Crystal Structure Of The 3rd Pdz Domain Of Intestin 1e-06
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 2e-05
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 2e-05
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 2e-05
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 2e-05
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 3e-05
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 3e-05
3sfj_A104 Crystal Structure Of Tax-Interacting Protein-1 (Tip 3e-05
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 3e-05
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 3e-05
4e3b_A102 Crystal Structure Of Tax-Interacting Protein-1 (Tip 3e-05
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 3e-05
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 3e-05
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 3e-05
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 3e-05
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 5e-05
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 6e-05
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 7e-05
2dls_A93 Solution Structure Of The Pdz Domain Of Human Rho G 8e-05
2kv8_A83 Solution Structure Ofrgs12 Pdz Domain Length = 83 8e-05
3bpu_A88 Crystal Structure Of The 3rd Pdz Domain Of Human Me 1e-04
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 2e-04
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 3e-04
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 4e-04
3tsw_A391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 6e-04
3shw_A 468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 6e-04
3tsw_B194 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 9e-04
>pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (slc9a3r2) Length = 88 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (255), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/82 (59%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
Query: 10 RLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNE 69
          RLC +++     GYGF+LHGEKG+ GQ+I +V+ GSPAEAA L+ GD ++EVN VN+  E
Sbjct: 3  RLCRLVRGEQ--GYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGE 60
Query: 70 NHNQVVQRIKAVPDETKLLVVD 91
           H+QVVQRIKAV  +T+LLVVD
Sbjct: 61 THHQVVQRIKAVEGQTRLLVVD 82
>pdb|2KRG|A Chain A, Solution Structure Of Human Sodium HYDROGEN EXCHANGE Regulatory Factor 1(150-358) Length = 216 Back     alignment and structure
>pdb|2KJD|A Chain A, Solution Structure Of Extended Pdz2 Domain From Nherf1 (150- 270) Length = 128 Back     alignment and structure
>pdb|1G9O|A Chain A, First Pdz Domain Of The Human Na+H+ EXCHANGER REGULATORY Factor Length = 91 Back     alignment and structure
>pdb|1GQ5|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2- Ar And Pdgfr Length = 91 Back     alignment and structure
>pdb|1I92|A Chain A, Structural Basis Of The Nherf Pdz1-Cftr Interaction Length = 91 Back     alignment and structure
>pdb|2JXO|A Chain A, Structure Of The Second Pdz Domain Of Nherf-1 Length = 98 Back     alignment and structure
>pdb|1GQ4|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2ar And Pdgfr Length = 90 Back     alignment and structure
>pdb|2OZF|A Chain A, The Crystal Structure Of The 2nd Pdz Domain Of The Human Nherf-1 (Slc9a3r1) Length = 92 Back     alignment and structure
>pdb|2HE4|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Nherf-2 (Slc9a3r2) Interacting With A Mode 1 Pdz Binding Motif Length = 90 Back     alignment and structure
>pdb|2EEJ|A Chain A, Solution Structure Of Fourth Pdz Domain Of Pdz Domain Containing Protein 1 Length = 96 Back     alignment and structure
>pdb|3TMH|A Chain A, Crystal Structure Of Dual-Specific A-Kinase Anchoring Protein 2 In Complex With Camp-Dependent Protein Kinase A Type Ii Alpha And Pdzk1 Length = 87 Back     alignment and structure
>pdb|2VSP|A Chain A, Crystal Structure Of The Fourth Pdz Domain Of Pdz Domain- Containing Protein 1 Length = 91 Back     alignment and structure
>pdb|4F8K|A Chain A, Molecular Analysis Of The Interaction Between The Prostacyclin Receptor And The First Pdz Domain Of Pdzk1 Length = 109 Back     alignment and structure
>pdb|2EDZ|A Chain A, Solution Structures Of The Pdz Domain Of Mus Musculus Pdz Domain-Containing Protein 1 Length = 114 Back     alignment and structure
>pdb|3NGH|A Chain A, Molecular Analysis Of The Interaction Of The Hdl Receptor Sr-Bi With The Adaptor Protein Pdzk1 Length = 106 Back     alignment and structure
>pdb|2D90|A Chain A, Solution Structure Of The Third Pdz Domain Of Pdz Domain Containing Protein 1 Length = 102 Back     alignment and structure
>pdb|3R69|A Chain A, Molecular Analysis Of The Interaction Of The Hdl-Receptor Sr-Bi With The Pdz3 Domain Of Its Adaptor Protein Pdzk1 Length = 89 Back     alignment and structure
>pdb|3R68|A Chain A, Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Length = 95 Back     alignment and structure
>pdb|3QDO|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) Fused To The Gly-Gly Linker Followed By C-Terminal (Eseskv) Of Girk3 Length = 109 Back     alignment and structure
>pdb|1Q3O|A Chain A, Crystal Structure Of The Shank Pdz-ligand Complex Reveals A Class I Pdz Interaction And A Novel Pdz-pdz Dimerization Length = 109 Back     alignment and structure
>pdb|3L4F|D Chain D, Crystal Structure Of Betapix Coiled-Coil Domain And Shank Pdz Complex Length = 132 Back     alignment and structure
>pdb|3QJM|A Chain A, Structural Flexibility Of Shank Pdz Domain Is Important For Its Binding To Different Ligands Length = 115 Back     alignment and structure
>pdb|2EEI|A Chain A, Solution Structure Of Second Pdz Domain Of Pdz Domain Containing Protein 1 Length = 106 Back     alignment and structure
>pdb|3QGL|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) In Complex With The Eseskv Peptide Corresponding To The C-Terminal Tail Of Girk3 Length = 101 Back     alignment and structure
>pdb|2V90|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Intestine- And Kidney-enriched Pdz Domain Ikepp (pdzd3) Length = 96 Back     alignment and structure
>pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure
>pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
>pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>pdb|3SFJ|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36 Inhibitor Peptide Length = 104 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|4E3B|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36-L (Ansrwptsil) Peptide Length = 102 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 Back     alignment and structure
>pdb|2KV8|A Chain A, Solution Structure Ofrgs12 Pdz Domain Length = 83 Back     alignment and structure
>pdb|3BPU|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Membrane Associated Guanylate Kinase, C677s And C709s Double Mutant Length = 88 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
2eei_A106 PDZ domain-containing protein 1; regulatory factor 1e-40
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-38
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 3e-38
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 5e-38
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-37
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 3e-37
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-37
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-37
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 5e-37
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 7e-37
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-36
2v90_A96 PDZ domain-containing protein 3; membrane, protein 8e-34
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-33
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 9e-31
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-30
2ego_A96 General receptor for phosphoinositides 1- associat 3e-29
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 5e-29
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-28
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 1e-28
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-27
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-27
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 5e-27
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 3e-26
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-25
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 8e-25
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 5e-24
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 1e-23
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 9e-23
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 9e-23
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 4e-20
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-19
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-19
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-19
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 5e-19
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 7e-19
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-18
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-18
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-18
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-18
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 5e-18
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-18
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 7e-18
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-17
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 1e-17
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 1e-17
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-17
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-17
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 3e-17
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 3e-17
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-17
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 4e-17
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-09
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 8e-17
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 8e-17
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-16
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 8e-16
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-16
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 7e-16
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 7e-16
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-15
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-15
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-15
2eeh_A100 PDZ domain-containing protein 7; structural genomi 3e-15
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-15
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 4e-15
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 7e-15
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 9e-15
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 9e-15
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 8e-14
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 1e-14
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-14
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 2e-14
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-14
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-14
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-14
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 3e-14
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-14
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-13
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-14
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 4e-14
3k1r_A192 Harmonin; protein-protein complex, alternative spl 4e-14
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 4e-14
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 5e-14
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 6e-14
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 6e-14
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 7e-14
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 1e-13
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-13
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-13
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-13
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-13
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-13
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 3e-13
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 3e-13
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 4e-13
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-13
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-09
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 4e-13
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-13
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 5e-13
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 5e-13
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 6e-13
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 6e-13
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 8e-13
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 8e-13
2awx_A105 Synapse associated protein 97; membrane protein, s 9e-13
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 9e-13
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-12
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-12
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-12
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-12
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-12
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-12
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-12
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-12
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-12
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-12
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-12
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-12
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-12
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 6e-11
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-05
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-12
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-12
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-12
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 4e-12
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 5e-12
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 5e-12
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 6e-12
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 6e-12
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 6e-12
2byg_A117 Channel associated protein of synapse-110; DLG2, P 7e-12
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 7e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 7e-12
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-11
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-11
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 1e-11
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-11
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-11
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-11
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-11
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-11
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-11
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-11
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 3e-11
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-11
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-11
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-07
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 4e-11
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 8e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 9e-11
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-10
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-10
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 3e-10
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 5e-10
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 8e-10
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 8e-10
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-09
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-09
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 4e-09
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 7e-09
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 5e-08
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 6e-08
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 7e-08
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 1e-07
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-07
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 5e-07
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 6e-05
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 6e-07
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 5e-05
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 1e-06
3k50_A403 Putative S41 protease; structural genomics, joint 2e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-05
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 3e-06
4fgm_A597 Aminopeptidase N family protein; structural genomi 7e-06
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 9e-06
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 9e-06
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 2e-05
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 4e-05
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 7e-05
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 9e-05
2kl1_A94 YLBL protein; structure genomics, structural genom 1e-04
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 2e-04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 2e-04
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 2e-04
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 3e-04
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 4e-04
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
 Score =  136 bits (344), Expect = 1e-40
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 2   SEDKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEV 61
           S   +   RLC+++K  +   YGF+L   +GK G Y+  +     A  AG+   DH+IEV
Sbjct: 2   SSGSSGQPRLCYLVK--EGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEV 59

Query: 62  NSVNICNENHNQVVQRIKAVPDETKLLVVDVASEEYFKSNNITISS 107
           N  N+ + +H +VV+++K        L+VD  +++         SS
Sbjct: 60  NGENVEDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKSGPSS 105
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.88
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.63
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.61
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.59
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.57
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.57
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.55
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.52
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.51
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.51
2d90_A102 PDZ domain containing protein 1; structural genomi 99.51
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.48
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.48
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.48
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.47
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.47
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.47
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.47
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.46
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.46
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.46
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.45
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.45
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.45
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.45
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.44
2ego_A96 General receptor for phosphoinositides 1- associat 99.44
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.44
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.44
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.44
2awx_A105 Synapse associated protein 97; membrane protein, s 99.44
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.44
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.43
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.43
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.43
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.42
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.42
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.42
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.42
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.42
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.41
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.41
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.41
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.41
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.41
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.41
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.4
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.4
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.4
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.4
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.4
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.39
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.39
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.39
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.39
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.38
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.38
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.38
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.38
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.37
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.37
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.37
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.37
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.37
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.37
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.37
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.37
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.37
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.37
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.37
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.36
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.35
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.35
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.35
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.35
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.35
1sgh_B39 Ezrin-radixin-moesin binding phosphoprotein 50; FE 99.35
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.34
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.34
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.34
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.34
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.33
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.33
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.33
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.33
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.33
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.33
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.33
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.32
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.32
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.32
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.32
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.32
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.32
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.31
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.31
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.31
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.31
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.31
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.3
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.3
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.3
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.3
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.3
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.3
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.3
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.3
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.3
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.29
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.29
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.29
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.29
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.28
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.28
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.28
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.27
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.27
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.27
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.27
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.26
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.26
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.26
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.26
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.25
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.25
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.25
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.24
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.24
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.23
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.23
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.23
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.22
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.22
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.22
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.21
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.21
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.21
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.21
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.2
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.2
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.83
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.18
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.18
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.18
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.17
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.17
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.16
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.15
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.15
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.14
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.13
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.13
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.13
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.11
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.11
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.1
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.09
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.07
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.05
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.03
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.02
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.02
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.98
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.96
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.9
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.85
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.8
1sgh_B39 Ezrin-radixin-moesin binding phosphoprotein 50; FE 98.77
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.74
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.65
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.61
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.59
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.58
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.57
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.54
2kl1_A94 YLBL protein; structure genomics, structural genom 98.5
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.49
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.43
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.42
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.42
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.37
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.32
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.28
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.28
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.25
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.2
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.2
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.2
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.15
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.12
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.09
3k50_A403 Putative S41 protease; structural genomics, joint 98.08
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.06
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.02
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.0
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.97
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.96
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.72
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.61
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.33
1k32_A1045 Tricorn protease; protein degradation, substrate g 97.3
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.53
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.49
2d10_E28 Ezrin-radixin-moesin binding phosphoprotein 50; pr 91.11
2d11_E28 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 90.35
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=3.5e-23  Score=187.04  Aligned_cols=91  Identities=51%  Similarity=0.739  Sum_probs=77.2

Q ss_pred             CCCCceEEEEEeeCCCCcceeEEEeccCCCCCeEEEEeCCCCHHHHcCCCCCCEEEEECCEEcCCCCHHHHHHHHHhCCC
Q psy10428          4 DKTPVVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPD   83 (309)
Q Consensus         4 ~~~~~pR~v~L~K~~~~~G~GFsl~ggk~~~Gi~V~~V~pgSpA~~AGLq~GD~Il~VNG~~V~~~sh~dvv~~Lk~s~~   83 (309)
                      ....++|.|.|.++.  .||||.+.++.+..|++|..|.+++||+++||+.||+|++|||..|.+.+|.++..+|+..+.
T Consensus         5 ~~~~~~r~v~l~k~~--~glG~~l~~~~~~~gv~V~~V~~gSpA~~aGL~~GD~Il~VNG~~V~~~s~~dl~~~l~~~g~   82 (216)
T 2krg_A            5 FTMLRPRLCTMKKGP--SGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGD   82 (216)
T ss_dssp             TTTCCCEEEEEECCS--SSSCEEECCCSSSCSCBEEEECTTSHHHHHTCCTTCBCCEETTEECTTCCTHHHHHHHHHHCS
T ss_pred             ccccceEEEEEEeCC--CCceEEEEecCCCCCeEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHHhcCC
Confidence            346789999999987  899999998876668999999999999999999999999999999988899999999987744


Q ss_pred             CeEEEEEEeCCee
Q psy10428         84 ETKLLVVDVASEE   96 (309)
Q Consensus        84 ~vvllvv~r~~~~   96 (309)
                      .+..+++.|++..
T Consensus        83 ~v~~l~V~R~g~~   95 (216)
T 2krg_A           83 ETKLLVVDRETDE   95 (216)
T ss_dssp             EEEEEECCHHHHH
T ss_pred             eEEEEEEEECCEE
Confidence            3426676665543
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sgh_B Ezrin-radixin-moesin binding phosphoprotein 50; FERM-peptide complex, structural protein; 3.50A {Homo sapiens} SCOP: j.117.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>1sgh_B Ezrin-radixin-moesin binding phosphoprotein 50; FERM-peptide complex, structural protein; 3.50A {Homo sapiens} SCOP: j.117.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2d10_E Ezrin-radixin-moesin binding phosphoprotein 50; protein-peptide complex, cell adhesion; 2.50A {Mus musculus} Back     alignment and structure
>2d11_E Na(+)/H(+) exchange regulatory cofactor NHE-RF2; protein-peptide complex, cell adhesion; 2.81A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 309
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 2e-26
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 6e-20
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-18
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 3e-18
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-16
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-16
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-16
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-16
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 3e-16
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-16
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 4e-16
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 1e-15
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 1e-15
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-15
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-15
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 3e-15
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 1e-14
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-14
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-14
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-14
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-14
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 3e-14
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 4e-14
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 4e-14
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 5e-14
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 5e-14
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-14
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 7e-14
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 8e-14
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 1e-13
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-13
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-13
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-13
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-13
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-13
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-13
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 2e-13
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-13
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-13
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-13
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 4e-13
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 7e-13
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-12
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-12
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 2e-12
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-12
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-12
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-12
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-12
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-12
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-11
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-11
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 3e-11
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 3e-11
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-11
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 3e-11
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 4e-11
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 5e-11
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 6e-11
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 7e-11
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 4e-10
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 5e-10
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-09
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 2e-09
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 7e-08
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 1e-05
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 0.003
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Na+/H+ exchanger regulatory factor, NHERF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 97.6 bits (243), Expect = 2e-26
 Identities = 48/88 (54%), Positives = 60/88 (68%), Gaps = 2/88 (2%)

Query: 10 RLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNE 69
          RLC + K    +GYGF+LHGEKGK GQYI  V+ GSPAE AGL  GD ++EVN  N+  E
Sbjct: 5  RLCCLEK--GPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKE 62

Query: 70 NHNQVVQRIKAVPDETKLLVVDVASEEY 97
           H QVV RI+A  +  +LLVVD  ++E 
Sbjct: 63 THQQVVSRIRAALNAVRLLVVDPETDEQ 90
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.71
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.62
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.62
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.61
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.59
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.59
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.58
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.57
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.56
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.56
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.56
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.56
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.55
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.54
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.54
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.54
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.53
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.52
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.51
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.51
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.5
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.5
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.5
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.49
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.49
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.46
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.45
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.45
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.44
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.42
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.42
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.42
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.41
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.41
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.41
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.41
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.4
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.39
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.39
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.36
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.35
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.34
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.33
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.33
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.32
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.29
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.29
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.29
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.25
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.24
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.23
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.22
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.2
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.09
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.91
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.76
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.54
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.45
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.44
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.35
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.34
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Na+/H+ exchanger regulatory factor, NHERF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.71  E-value=4.3e-17  Score=126.46  Aligned_cols=85  Identities=55%  Similarity=0.886  Sum_probs=77.5

Q ss_pred             ceEEEEEeeCCCCcceeEEEeccCCCCCeEEEEeCCCCHHHHcCCCCCCEEEEECCEEcCCCCHHHHHHHHHhCCCCeEE
Q psy10428          8 VVRLCHILKWTDFDGYGFNLHGEKGKTGQYIGKVDEGSPAEAAGLKEGDHIIEVNSVNICNENHNQVVQRIKAVPDETKL   87 (309)
Q Consensus         8 ~pR~v~L~K~~~~~G~GFsl~ggk~~~Gi~V~~V~pgSpA~~AGLq~GD~Il~VNG~~V~~~sh~dvv~~Lk~s~~~vvl   87 (309)
                      .||+|.|.|+.  .+|||.|.++....++||..|.+||||+++||++||+|++|||.++.+++|++++.+|+.+++.+.+
T Consensus         3 ~Pr~v~l~k~~--~g~Gf~i~~~~~~~~~~V~~V~~g~~A~~aGl~~GD~Il~VNg~~v~~~t~~e~~~ll~~~~~~v~L   80 (91)
T d1g9oa_           3 LPRLCCLEKGP--NGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRL   80 (91)
T ss_dssp             CCEEEEEECBT--TBCCEEEEECTTCSSEEEEEECTTSHHHHTTCCTTCEEEEETTEECTTCCHHHHHHHHHTCSSEEEE
T ss_pred             CCEEEEEEECC--CeeeEEEEecCCCCCEEEEEEcCCCHHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHHcCCCeEEE
Confidence            58999999987  8999999998877899999999999999999999999999999999999999999999998877777


Q ss_pred             EEEEeCC
Q psy10428         88 LVVDVAS   94 (309)
Q Consensus        88 lvv~r~~   94 (309)
                      ++++++.
T Consensus        81 ~v~~~~~   87 (91)
T d1g9oa_          81 LVVDPET   87 (91)
T ss_dssp             EEECCCC
T ss_pred             EEECCCC
Confidence            6665543
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure