Diaphorina citri psyllid: psy10446


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MCLISPKDQDFLIDWKGVTFEPSSFSGRDWQWNVNSKEEAYLKILKMFEDRRTAPYSIHQIALTGASEGKAVGEWFGPNTVAQVLRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRYI
ccccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccEEEEEcccccEEHHHHHHHHHHccccccccccccEEEEEEEccccccHHHHHHHHccccccc
********QDFLIDWKGVTFEPSSFSGRDWQWNVNSKEEAYLKILKMFEDRRTAPYSIHQIALTGASEGKAVGEWFGPNTVAQVLRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLISPKDQDFLIDWKGVTFEPSSFSGRDWQWNVNSKEEAYLKILKMFEDRRTAPYSIHQIALTGASEGKAVGEWFGPNTVAQVLRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRYI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine protease ATG4A Cysteine protease required for autophagy, which is able to cleave the C-terminal part of proteins that may be subsequently converted to a smaller form, with a revealed C-terminal glycine, considered to be the phosphatidylethanolamine (PE)-conjugated form. This conjugated form has the capacity for the binding to autophagosomes.confidentQ6PZ05
Cysteine protease ATG4A Cysteine protease required for autophagy, which is able to cleave the C-terminal part of proteins that may be subsequently converted to a smaller form, with a revealed C-terminal glycine, considered to be the phosphatidylethanolamine (PE)-conjugated form. This conjugated form has the capacity for the binding to autophagosomes.confidentQ5ZIW7
Cysteine protease ATG4B Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes.confidentQ9Y4P1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010508 [BP]positive regulation of autophagyprobableGO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0031331, GO:0031325, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0010506, GO:0050789, GO:0048522
GO:0008234 [MF]cysteine-type peptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P82, chain A
Confidence level:very confident
Coverage over the Query: 22-154
View the alignment between query and template
View the model in PyMOL