Diaphorina citri psyllid: psy10447


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MTDIHCHTLSIESFDSVLKPLWKGIRTHRGKGLAAFLKAIGYLIPLMDAEYANYYTKEVMLILIREFQSPDEEMKKIVLKVVKQCCATDGVEAQYIKDEILPPFFKNFWNHRMALDRRNYRQLVDTTVEIANKVGASEIINRVVDDLKDENEQYRKMVMESIEKTN
ccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHcc
***IHCHTLSIESFDSVLKPLWKGIRTHRGKGLAAFLKAIGYLIPLMDAEYANYYTKEVMLILIREFQSPDEEMKKIVLKVVKQCCATDGVEAQYIKDEILPPFFKNFWNHRMALDRRNYRQLVDTTVEIANKVGASEIINRVVDDLKDENEQYRKMVMESIEKT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDIHCHTLSIESFDSVLKPLWKGIRTHRGKGLAAFLKAIGYLIPLMDAEYANYYTKEVMLILIREFQSPDEEMKKIVLKVVKQCCATDGVEAQYIKDEILPPFFKNFWNHRMALDRRNYRQLVDTTVEIANKVGASEIINRVxxxxxxxxxxxxxxxxxxxxxTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor 3B subunit 1 Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.very confidentO75533
Splicing factor 3B subunit 1 Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.very confidentQ99NB9
U2 snRNP component prp10 Contacts pre-mRNA on both sides of the branch site early in spliceosome assembly.confidentQ10178

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0003682 [MF]chromatin bindingconfidentGO:0003674, GO:0005488
GO:0009987 [BP]cellular processconfidentGO:0008150
GO:0005689 [CC]U12-type spliceosomal complexconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0014032 [BP]neural crest cell developmentprobableGO:0030154, GO:0048468, GO:0007275, GO:0044699, GO:0014033, GO:0014031, GO:0048864, GO:0048869, GO:0048513, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0048731, GO:0060485, GO:0044707, GO:0048856, GO:0008150
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0009952 [BP]anterior/posterior pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007281 [BP]germ cell developmentprobableGO:0032502, GO:0044702, GO:0048609, GO:0032504, GO:0022414, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0019953, GO:0044767, GO:0003006, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0009987, GO:0000003, GO:0007276, GO:0048856
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0040020 [BP]regulation of meiosisprobableGO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0040007 [BP]growthprobableGO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0005686 [CC]U2 snRNPprobableGO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B3U, chain A
Confidence level:confident
Coverage over the Query: 31-164
View the alignment between query and template
View the model in PyMOL
Template: 4DB6, chain A
Confidence level:probable
Coverage over the Query: 17-165
View the alignment between query and template
View the model in PyMOL