Diaphorina citri psyllid: psy10457

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
NFTSPPDDKLSHQSSLCGEEPCSFEPSGLEPATPHESLSRQSTAEYDPGYSARVDFALKLGYTEDLVQTALNKLGPNPSHNELLAELIKLGAQVPTSFIQDNEQDCMPYPQAKLRPVVIDGSNVAMSHGNKELFSCIGIKICVDWFRARGHKEITVFVPKWRKESCRPDNLIKNQEVLSELEKDRILVYTPSRLIGGKRLVCYDDRFILRLAADTDGIVVSNDNYRDLCLESPDFRKVVEDRILMYSFVNDRFMPPEDPLGRSGPSLDKFLTIDYKQNSTGAPCPYGRKCTYGSKCKFNHPERGPWPHKTVTERLMEHAQKQMSEKRQVNKTLSCPAVPNQYQHQEQQVTVHPQKTLLSRTRSYAPDSHPEAHGSYSNLSQNSDQGAPLHQRLQRQLSLNPYEEVPQGAPPHQHIASQNSSHNGGSSNGLNGYLNGHGFHNGHNAPNGSHNGMTRNPYEEQKERMRLHYHLASLFPEDQVVAAMQAHPGETSAHVLCATILAMFPPSR
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccEEEEcccHHHHccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHcccEEEcccccccccccccccHHHHHHHHHccccEEEEcccHHHHHHccHHHHHHHHHHccccEEcccCCccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHcccccc
************************************************GYSARVDFALKLGYTEDLVQTALNKLGPNPSHNELLAELIKLGAQ******************AKLRPVVIDGSNVAMSHGNKELFSCIGIKICVDWFRARGHKEITVFVPKWRKESCRPDNLIKNQEVLSELEKDRILVYTPSRLIGGKRLVCYDDRFILRLAADTDGIVVSNDNYRDLCLESPDFRKVVEDRILMYSFVNDRFMPPEDPLGRSGPSLDKFLTIDYKQNSTGAPCPYGRKCTYGSKCKFN***********************************************************************************************************************************************************************LHYHLASLFPEDQVVAAMQAHPGETSAHVLCATILAMFPP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NFTSPPDDKLSHQSSLCGEEPCSFEPSGLEPATPHESLSRQSTAEYDPGYSARVDFALKLGYTEDLVQTALNKLGPNPSHNELLAELIKLGAQVPTSFIQDNEQDCMPYPQAKLRPVVIDGSNVAMSHGNKELFSCIGIKICVDWFRARGHKEITVFVPKWRKESCRPDNLIKNQEVLSELEKDRILVYTPSRLIGGKRLVCYDDRFILRLAADTDGIVVSNDNYRDLCLESPDFRKVVEDRILMYSFVNDRFMPPEDPLGRSGPSLDKFLTIDYKQNSTGAPCPYGRKCTYGSKCKFNHPERGPWPHKTVTERLMEHAQKQMSEKRQVNKTLSCPAVPNQYQHQEQQVTVHPQKTLLSRTRSYAPDSHPEAHGSYSNLSQNSDQGAPLHQRLQRQLSLNPYEEVPQGAPPHQHIASQNSSHNGGSSNGLNGYLNGHGFHNGHNAPNGSHNGMTRNPYEEQKERMRLHYHLASLFPEDQVVAAMQAHPGETSAHVLCATILAMFPPSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ribonuclease ZC3H12C May function as RNase and regulate the levels of target RNA species.confidentQ9C0D7
Probable ribonuclease ZC3H12C May function as RNase and regulate the levels of target RNA species.confidentQ5DTV4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:2000134 [BP]negative regulation of G1/S transition of mitotic cell cycleprobableGO:0007346, GO:2000045, GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0048523, GO:0050789, GO:1901988
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V33, chain A
Confidence level:very confident
Coverage over the Query: 113-275
View the alignment between query and template
View the model in PyMOL
Template: 1IXS, chain A
Confidence level:probable
Coverage over the Query: 51-89
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 364-370
View the alignment between query and template
View the model in PyMOL