Diaphorina citri psyllid: psy10458


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
MWSFKNVFSFSKALKDPSGNVLSKYFVPSIEYRRLEAQRSILFGTVQSMHHYTLPGQTHFVIVEMKDSQVTRRILNKCGHLDKSQVIPVRSPFLWFRANKNKTKLSDESDYAKINCDTHNVFPPTEDHVRECLASCNTITQQMTTLHNITKMNDINTRLRFLVAYQVELALSGLFPLCAIFPFGSSVNNFGKLGCDLDLVLQLDLQSQGDNDQCRLMFHCKSSLGSERSQTLRHLETVGDLLQLFLPGCSQLFLPGCSQVKRILGARVPIIKYNHDMSALECDLSMTNLTALYMAELLYLFGEIDWRVRPLVFTIKKWAKDINLTNPTPGRWITNFSLTLLVLFYLQSVKVLPPLKLLIDEASLKDRRISEDGVNCTFVRDITKLQFHPSIPEQSTDSLTTLLFGFFEFYSQYDFNNQGISLYLGSPIPKPEHGALYINNPLERGLNVSKNVSFEELERLKVEVRNASWTLESTANSNNKPSHTPSESWGLLELFKKQNLSEKAKSVFFSEKSRPKERMVSVEDLFSTETSEDSQVPVEPDFKKRKPISAQTLKAVQKAMKTK
ccccccccccccccccccccccccccHHHHHHHHHHHccEEEEEEcccCEEEEEccccEEEEEEEccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccEEECccccccEEEEECcccccEEEEEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHcccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHcccccccEEEEcccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcc
*WS**NVFSFSKALKDPSGNVLSKYFVPSIEYRRLEAQRSILFGTVQSMHHYTLPGQTHFVIVEMKDSQVTRRILNKCGHLDKSQVIPVRSPFLWFRANKNK*****ESDYAKINCDTHNVFPPTEDHVRECLASCNTITQQMTTLHNITKMNDINTRLRFLVAYQVELALSGLFPLCAIFPFGSSVNNFGKLGCDLDLVLQLDLQSQGDNDQCRLMFHCKSSLGSERSQTLRHLETVGDLLQLFLPGCSQLFLPGCSQVKRILGARVPIIKYNHDMSALECDLSMTNLTALYMAELLYLFGEIDWRVRPLVFTIKKWAKDINLTNPTPGRWITNFSLTLLVLFYLQSVKVLPPLKLLIDEASLKDRRISEDGVNCTFVRDITKLQFHPSIPEQSTDSLTTLLFGFFEFYSQYDFNNQGISLYLGSPIPKPEHGALYINNPLERGLNVSKNVSFEELERLKVEVRNASWTLE******************LLE**********************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWSFKNVFSFSKALKDPSGNVLSKYFVPSIEYRRLEAQRSILFGTVQSMHHYTLPGQTHFVIVEMKDSQVTRRILNKCGHLDKSQVIPVRSPFLWFRANKNKTKLSDESDYAKINCDTHNVFPPTEDHVRECLASCNTITQQMTTLHNITKMNDINTRLRFLVAYQVELALSGLFPLCAIFPFGSSVNNFGKLGCDLDLVLQLDLQSQGDNDQCRLMFHCKSSLGSERSQTLRHLETVGDLLQLFLPGCSQLFLPGCSQVKRILGARVPIIKYNHDMSALECDLSMTNLTALYMAELLYLFGEIDWRVRPLVFTIKKWAKDINLTNPTPGRWITNFSLTLLVLFYLQSVKVLPPLKLLIDEASLKDRRISEDGVNCTFVRDITKLQFHPSIPEQSTDSLTTLLFGFFEFYSQYDFNNQGISLYLGSPIPKPEHGALYINNPLERGLNVSKNVSFEELERLKVEVRNASWTLESTANSNNKPSHTPSESWGLLELFKKQNLSEKAKSVFFSEKSRPKERMVSVEDLFSTETSEDSQVPVEPDFKKRKPISAQTLKAVQKAMKTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Poly(A) RNA polymerase, mitochondrial Polymerase that creates the 3' poly(A) tail of mitochondrial transcripts. Can use all four nucleotides, but has higher activity with ATP and UTP (in vitro). Plays a role in replication-dependent histone mRNA degradation. May be involved in the terminal uridylation of mature histone mRNAs before their degradation is initiated. Might be responsible for the creation of some UAA stop codons which are not encoded in mtDNA.confidentQ9NVV4
Poly(A) RNA polymerase, mitochondrial Polymerase that creates the 3' poly(A) tail of mitochondrial transcripts. Can use all four nucleotides, but has higher activity with ATP and UTP (in vitro). Plays a role in replication-dependent histone mRNA degradation. May be involved in the terminal uridylation of mature histone mRNAs before their degradation is initiated. Might be responsible for the creation of some UAA stop codons which are not encoded in mtDNA.confidentQ9D0D3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071044 [BP]histone mRNA catabolic processprobableGO:0008334, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0004652 [MF]polynucleotide adenylyltransferase activityprobableGO:0016779, GO:0016772, GO:0070566, GO:0003824, GO:0016740, GO:0003674
GO:0006378 [BP]mRNA polyadenylationprobableGO:0090304, GO:0034641, GO:0006807, GO:0043631, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0002134 [MF]UTP bindingprobableGO:0043168, GO:0097159, GO:0019103, GO:1901265, GO:0043167, GO:0036094, GO:0003674, GO:0005488, GO:0032549, GO:0001884, GO:0032557, GO:0000166, GO:0032551, GO:1901363, GO:0032553, GO:0001882
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PQ1, chain A
Confidence level:very confident
Coverage over the Query: 25-92,115-365,393-422,445-474,488-496
View the alignment between query and template
View the model in PyMOL
Template: 4E8F, chain A
Confidence level:very confident
Coverage over the Query: 134-205,223-244,256-501
View the alignment between query and template
View the model in PyMOL