Diaphorina citri psyllid: psy10465


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MRHANKLSHQDLEQIRRDITSRLWFTYRKGFVPIGDSGLTTDKGWGCMLRCGQMVIAQALLFLHLGRDWQWNVNSKEEAYLKILKMFEDRRTAPYSIHQIALTGASEGKAVGEWFGPNTVAQVLRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRASSNPQWQPLVLVIPLRLGIQDINPVYINGIKKCYALPISPVYDMVKILSSTYNMQTPRYEFTFPQSLGVIGGKPNHALYFIGYVGNDVIFLDPHTNQNIGCVYDKEQDSEKKLDSTYHCPQASRLHILHMDPSIAVVSQRSYSDYKNV
ccccccccHHHHHHHHHHccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccEEEEEEcccEEEEHHHHHHHccccccccccccccEEEEEccccccccccHHHHHHHHHHHccccccccHHHEEEcccccccccccccccccccccccccccCEEEEEEEEccEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHccc
*********QDLEQIRRDITSRLWFTYRKGFVPIGDSGLTTDKGWGCMLRCGQMVIAQALLFLHLGRDWQWNVNSKEEAYLKILKMFEDRRTAPYSIHQIALTGASEGKAVGEWFGPNTVAQVLRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRASSNPQWQPLVLVIPLRLGIQDINPVYINGIKKCYALPISPVYDMVKILSSTYNMQTPRYEFTFPQSLGVIGGKPNHALYFIGYVGNDVIFLDPHTNQNIGCVYDKEQDSEKKLDSTYHCPQASRLHILHMDPSIAVVSQRSYSD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRHANKLSHQDLEQIRRDITSRLWFTYRKGFVPIGDSGLTTDKGWGCMLRCGQMVIAQALLFLHLGRDWQWNVNSKEEAYLKILKMFEDRRTAPYSIHQIALTGASEGKAVGEWFGPNTVAQVLRKLAKYDDWSSIVFHVALDNTLVVNQVKKLCTTNKRASSNPQWQPLVLVIPLRLGIQDINPVYINGIKKCYALPISPVYDMVKILSSTYNMQTPRYEFTFPQSLGVIGGKPNHALYFIGYVGNDVIFLDPHTNQNIGCVYDKEQDSEKKLDSTYHCPQASRLHILHMDPSIAVVSQRSYSDYKNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine protease ATG4B Cysteine protease required for autophagy, which is able to cleave the C-terminal part of proteins that may be subsequently converted to a smaller form, with a revealed C-terminal glycine, considered to be the phosphatidylethanolamine (PE)-conjugated form. This conjugated form has the capacity for the binding to autophagosomes.confidentQ6DG88
Probable cysteine protease atg4 Probable cysteine protease necessary for autophagy and cytoplasm to vacuole transport (Cvt).confidentQ2U5B0
Cysteine protease ATG4A Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. Preferred substrate is GABARAPL2 followed by MAP1LC3A and GABARAP.confidentQ8WYN0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008234 [MF]cysteine-type peptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0010508 [BP]positive regulation of autophagyprobableGO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0031331, GO:0031325, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0010506, GO:0050789, GO:0048522
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0006914 [BP]autophagyprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0005575 [CC]cellular_componentprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CY7, chain A
Confidence level:very confident
Coverage over the Query: 5-194,222-309
View the alignment between query and template
View the model in PyMOL