Diaphorina citri psyllid: psy10468


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
AALLVAFINIQLPLYLGNIINILAKFTQDSTAQLSFMSEMKEPALKLVGLYVAQSVFTCVYISLLSGLGERIAAKLRCQLFESILKQDIAFFDSTRTGELVDSAKPNIKNKLNPIHNHVIRMITGAFRSSPLNSIHAESMVLGTLYFGGHLMASNTLTAGDLMSFLVSTQMIQRSMAQMSLLFGSYIKGLSSGARIFQLRCQLFESILKQDIAFFDSTRTGELVDRLTTDVQEFKSSFKLVVSQGLRNGAQVIGAVSSLLIISPSLTLGMLGIVPIVIISGTFIGSLLRSLSREAQNQAAKAVTIGEEAISNIRTVRAFAMEPYEVRLFTDQVSLSCTLQERLGVGVGMFQAGTNLFLNGKKWDS
cHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
AALLVAFINIQLPLYLGNIINILAKFTQDSTAQLSFMSEMKEPALKLVGLYVAQSVFTCVYISLLSGLGERIAAKLRCQLFESILKQDIAFFDSTRTGEL**********KLNPIHNHVIRMITGAFRSSPLNSIHAESMVLGTLYFGGHLMASNTLTAGDLMSFLVSTQMIQRSMAQMSLLFGSYIKGLSSGARIFQLRCQLFESILKQDIAFFDSTRTGELVDRLTTDVQEFKSSFKLVVSQGLRNGAQVIGAVSSLLIISPSLTLGMLGIVPIVIISGTFIGSLLRSLSREAQNQAAKAVTIGEEAISNIRTVRAFAMEPYEVRLFTDQVSLSCTLQERLGVGVGMFQAGTNLFLNGKKWD*
xxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AALLVAFINIQLPLYLGNIINILAKFTQDSTAQLSFMSEMKEPALKLVGLYVAQSVFTCVYISLLSGLGERIAAKLRCQLFESILKQDIAFFDSTRTGELVDSAKPNIKNKLNPIHNHVIRMITGAFRSSPLNSIHAESMVLGTLYFGGHLMASNTLTAGDLMSFLVSTQMIQRSMAQMSLLFGSYIKGLSSGARIFQLRCQLFESILKQDIAFFDSTRTGELVDRLTTDVQEFKSSFKLVVSQGLRNGAQVIGAVSSLLIISPSLTLGMLGIVPIVIISGTFIGSLLRSLSREAQNQAAKAVTIGEEAISNIRTVRAFAMEPYEVRLFTDQVSLSCTLQERLGVGVGMFQAGTNLFLNGKKWDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-binding cassette sub-family B member 8, mitochondrial confidentB2GUP8
ATP-binding cassette sub-family B member 8, mitochondrial confidentQ56A55

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 3-98,222-358
View the alignment between query and template
View the model in PyMOL
Template: 3B5X, chain A
Confidence level:very confident
Coverage over the Query: 42-198
View the alignment between query and template
View the model in PyMOL
Template: 4F4C, chain A
Confidence level:very confident
Coverage over the Query: 165-359
View the alignment between query and template
View the model in PyMOL