Diaphorina citri psyllid: psy10473


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
VGTGHIGVYDKEQDSEKKLDSTYHCPQASRLHILHMDPSIAVCFLCKTENDFASLCSQIRAELRPEQQPLFELIEDPIEDWTPTQPRPSNLGGTSSPSCSSMRRQPRRVSGVGEGSDDDFEFLG
cccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccEEcc
***GHIGVYDKEQDSEKKLDSTYHCPQASRLHILHMDPSIAVCFLCKTENDFASLCSQIRAELR***Q*LFELIE***************************************GSDDDFEFLG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGTGHIGVYDKEQDSEKKLDSTYHCPQASRLHILHMDPSIAVCFLCKTENDFASLCSQIRAELRPEQQPLFELIEDPIEDWTPTQPRPSNLGGTSSPSCSSMRRQPRRVSGVGEGSDDDFEFLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008233 [MF]peptidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P82, chain A
Confidence level:very confident
Coverage over the Query: 20-81
View the alignment between query and template
View the model in PyMOL
Template: 2CY7, chain A
Confidence level:very confident
Coverage over the Query: 20-106
View the alignment between query and template
View the model in PyMOL