Diaphorina citri psyllid: psy1047


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP
ccccccccccEEEEEEcccccccEEEEEEEECcccccccccEEEEEECccccccEEEccccccccEEEccccccccccccCEEEEEcccccccccccEEEEEEEEECcccccccccEEEEEEEECcc
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 1-64,85-125
View the alignment between query and template
View the model in PyMOL