Psyllid ID: psy1047

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP
ccccccccccEEEEEEcccccccEEEEEEEEEcccccccccEEEEEEEccccccEEEccccccccEEEccccccccccccEEEEEEcccccccccccEEEEEEEEEEcccccccccEEEEEEEEEcc
ccccccccccEEEEEEcccccccEEEEEEEEcccccccccEEEEEEEccccccEEEEcccccEEEEEEEcccccHHcccccEEEEEEEEEcccccccEEEEEEEEEccccccccEEEEccccccccc
mnapvfsdFVYQATvkenqpigTLVITLkaadadppgmnskisysvrggdglgyftidnegplnhfrivptkidpgtkkkeYNIVVLKLLDreiaplgynltlravdkgtppretykatprngltcp
mnapvfsdFVYQAtvkenqpiGTLVITlkaadadppgMNSKISYSVRGGDGLGYFTidnegplnhfrivptkidpgtkkkeYNIVVLKLLDREIAPLGYNLtlravdkgtppretykatprngltcp
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP
****VFSDFVYQATVKENQPIGTLVITLKAAD********KISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAV*********************
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRE*************
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLTCP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query127 2.2.26 [Sep-21-2011]
Q9VW71 4705 Fat-like cadherin-related yes N/A 0.708 0.019 0.416 6e-14
Q2PZL6 4981 Protocadherin Fat 4 OS=Mu yes N/A 0.763 0.019 0.341 1e-10
Q6V0I7 4981 Protocadherin Fat 4 OS=Ho yes N/A 0.763 0.019 0.333 8e-10
Q8R508 4555 Protocadherin Fat 3 OS=Ra no N/A 0.708 0.019 0.357 2e-09
Q8TDW7 4589 Protocadherin Fat 3 OS=Ho no N/A 0.708 0.019 0.357 2e-09
Q9NYQ8 4349 Protocadherin Fat 2 OS=Ho no N/A 0.708 0.020 0.348 3e-09
Q5F226 4351 Protocadherin Fat 2 OS=Mu no N/A 0.708 0.020 0.348 4e-09
O88277 4351 Protocadherin Fat 2 OS=Ra no N/A 0.708 0.020 0.348 5e-09
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu no N/A 0.708 0.019 0.357 5e-09
Q14517 4588 Protocadherin Fat 1 OS=Ho no N/A 0.708 0.019 0.383 6e-09
>sp|Q9VW71|FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster GN=kug PE=2 SV=2 Back     alignment and function desciption
 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 6/96 (6%)

Query: 3    APVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGP 62
            AP F DFVY+  VKEN+P GT V+ + A D D   +NSKI+YS+ GGDGLG F ++++G 
Sbjct: 1082 APEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGS 1141

Query: 63   LNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLG 98
            +       +++D  TK   +  + L   D  I PL 
Sbjct: 1142 ITSL----SQLDAETKN--FYWLTLCAQDCAIVPLS 1171
Required for the planar polarity of actin filament orientation at the basal side of ovarian follicle cells. Required for proper egg chamber shape; elongation of the egg chamber during oogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q2PZL6|FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus GN=Fat4 PE=1 SV=2 Back     alignment and function description
>sp|Q6V0I7|FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=1 SV=2 Back     alignment and function description
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description
>sp|Q8TDW7|FAT3_HUMAN Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 Back     alignment and function description
>sp|Q9NYQ8|FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens GN=FAT2 PE=1 SV=2 Back     alignment and function description
>sp|Q5F226|FAT2_MOUSE Protocadherin Fat 2 OS=Mus musculus GN=Fat2 PE=2 SV=1 Back     alignment and function description
>sp|O88277|FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus GN=Fat2 PE=1 SV=1 Back     alignment and function description
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function description
>sp|Q14517|FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens GN=FAT1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
345497484 4817 PREDICTED: fat-like cadherin-related tum 0.708 0.018 0.473 1e-17
350417212 4739 PREDICTED: fat-like cadherin-related tum 0.708 0.018 0.473 3e-17
189234730 4676 PREDICTED: similar to fat2 CG7749-PA [Tr 0.937 0.025 0.410 4e-17
270002748 4637 cadherin [Tribolium castaneum] 0.937 0.025 0.410 4e-17
307210686 1079 Putative fat-like cadherin-related tumor 0.456 0.053 0.655 4e-17
380020280 4753 PREDICTED: LOW QUALITY PROTEIN: fat-like 0.700 0.018 0.468 9e-17
383855810 4739 PREDICTED: fat-like cadherin-related tum 0.708 0.018 0.464 2e-16
332025272 1179 Putative fat-like cadherin-related tumor 0.433 0.046 0.689 4e-16
307179933 998 Putative fat-like cadherin-related tumor 0.433 0.055 0.655 1e-15
340728577 931 PREDICTED: fat-like cadherin-related tum 0.346 0.047 0.65 2e-15
>gi|345497484|ref|XP_001600457.2| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 67/112 (59%), Gaps = 22/112 (19%)

Query: 1    MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNE 60
            ++APVF+DFV  A+V ENQP+ TLV  +KA DADPPG +S+I YS+RGGDG+G F+ID+E
Sbjct: 1118 LHAPVFNDFVISASVSENQPLNTLVTQVKAKDADPPGGDSRIGYSIRGGDGVGLFSIDDE 1177

Query: 61   GPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPP 112
            G                     NI    +LD E A  GY LT+ A D G  P
Sbjct: 1178 G---------------------NIRTKAVLDVE-AKAGYWLTVYAQDHGVVP 1207

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350417212|ref|XP_003491311.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|189234730|ref|XP_973752.2| PREDICTED: similar to fat2 CG7749-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002748|gb|EEZ99195.1| cadherin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307210686|gb|EFN87109.1| Putative fat-like cadherin-related tumor suppressor-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380020280|ref|XP_003694018.1| PREDICTED: LOW QUALITY PROTEIN: fat-like cadherin-related tumor suppressor homolog [Apis florea] Back     alignment and taxonomy information
>gi|383855810|ref|XP_003703403.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|332025272|gb|EGI65444.1| Putative fat-like cadherin-related tumor suppressor-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307179933|gb|EFN68068.1| Putative fat-like cadherin-related tumor suppressor-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340728577|ref|XP_003402597.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog, partial [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
UNIPROTKB|E2R353 4591 FAT1 "Uncharacterized protein" 0.464 0.012 0.466 1e-13
UNIPROTKB|F6XXM1 5056 FAT1 "Uncharacterized protein" 0.464 0.011 0.466 1.2e-13
UNIPROTKB|E1BKL9 4587 FAT1 "Uncharacterized protein" 0.464 0.012 0.45 2.1e-13
UNIPROTKB|F1SER9 4587 FAT1 "Uncharacterized protein" 0.464 0.012 0.466 3.3e-13
UNIPROTKB|F1LP84 4586 Fat1 "Protein Fat1" [Rattus no 0.464 0.012 0.5 4.2e-13
UNIPROTKB|F1LR23 4589 Fat1 "Protein Fat1" [Rattus no 0.464 0.012 0.5 4.2e-13
RGD|621254 4589 Fat1 "FAT tumor suppressor hom 0.464 0.012 0.5 4.2e-13
UNIPROTKB|G3V9W9 4589 Fat1 "RCG59113" [Rattus norveg 0.464 0.012 0.5 4.2e-13
ZFIN|ZDB-GENE-050610-10 948 pcdh2g1 "protocadherin 2 gamma 0.338 0.045 0.477 8.5e-13
ZFIN|ZDB-GENE-050202-4 941 pcdh1a4 "protocadherin 1 alpha 0.480 0.064 0.469 1.3e-12
UNIPROTKB|E2R353 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 143 (55.4 bits), Expect = 1.0e-13, Sum P(2) = 1.0e-13
 Identities = 28/60 (46%), Positives = 41/60 (68%)

Query:     1 MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNE 60
             +++PVFS FV +  VKE+ P+G+ V+T+ A D D  G + +I YS+R G G+G F ID E
Sbjct:  1029 LHSPVFSSFVEKGVVKEDVPVGSSVMTVSARDEDT-GRDGEIRYSIRDGSGVGVFKIDEE 1087
GO:0016021 "integral to membrane" evidence=IEA
GO:0007156 "homophilic cell adhesion" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|F6XXM1 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKL9 FAT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SER9 FAT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP84 Fat1 "Protein Fat1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LR23 Fat1 "Protein Fat1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|621254 Fat1 "FAT tumor suppressor homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9W9 Fat1 "RCG59113" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050610-10 pcdh2g1 "protocadherin 2 gamma 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050202-4 pcdh1a4 "protocadherin 1 alpha 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 2e-21
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-17
smart0011281 smart00112, CA, Cadherin repeats 7e-10
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 81.6 bits (202), Expect = 2e-21
 Identities = 35/106 (33%), Positives = 48/106 (45%), Gaps = 22/106 (20%)

Query: 10  VYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIV 69
            Y+ +V EN P GT+V+T+ A D D  G N +++YS+  G+  G F+ID           
Sbjct: 1   SYEVSVPENAPPGTVVLTVSATDPD-SGENGEVTYSIVSGNEDGLFSID----------- 48

Query: 70  PTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRET 115
                         I   K LDRE     Y LT+ A D G PP  +
Sbjct: 49  ---------PSTGEITTAKPLDREEQSS-YTLTVTATDGGGPPLSS 84

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 127
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.91
KOG4289|consensus 2531 99.82
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.78
KOG1219|consensus 4289 99.75
KOG4289|consensus 2531 99.75
cd00031 199 CA Cadherin repeat domain; Cadherins are glycoprot 99.73
KOG1219|consensus 4289 99.72
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.66
KOG1834|consensus 952 99.0
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.72
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 97.61
KOG1834|consensus 952 97.12
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 95.98
PF0534549 He_PIG: Putative Ig domain; InterPro: IPR008009 Th 93.21
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 88.38
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information 
Probab=99.91  E-value=5.7e-23  Score=130.33  Aligned_cols=92  Identities=42%  Similarity=0.613  Sum_probs=89.0

Q ss_pred             eEEEEeCCCCCCeEEEEEEEEeCCCCCCCCcEEEEEEeCCCCCcEEEeCCCCeEEEeeeccccCCCCCCceeeEEEccCC
Q psy1047          11 YQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKKEYNIVVLKLL   90 (127)
Q Consensus        11 y~~~v~E~~~~g~~v~~~~a~D~D~~g~n~~i~y~i~~~~~~~~F~i~~~tg~i~~~~~~~~~~~~~~~~~~~l~~~~~l   90 (127)
                      |.+.|+|+.++|+.++++.|.|+|. +.|+.++|+|..+++..+|.|++.+|.|                    .+.++|
T Consensus         1 Y~~~v~E~~~~g~~v~~v~a~D~D~-~~n~~i~y~i~~~~~~~~F~I~~~tg~i--------------------~~~~~L   59 (93)
T PF00028_consen    1 YSFSVPENAPPGTVVGQVTATDPDS-GPNSQITYSILGGNPDGLFSIDPNTGEI--------------------SLKKPL   59 (93)
T ss_dssp             EEEEEETTGSTSSEEEEEEEEESST-STTSSEEEEEEETTSTTSEEEETTTTEE--------------------EESSSS
T ss_pred             CEEEEECCCCCCCEEEEEEEEeCCC-CCCceEEEEEecCcccCceEEeeeeecc--------------------ccceec
Confidence            8899999999999999999999997 9999999999998889999999999999                    999999


Q ss_pred             CCCCCCCeEEEEEEEEEC-CCCCcceeEEEEEEeE
Q psy1047          91 DREIAPLGYNLTLRAVDK-GTPPRETYKATPRNGL  124 (127)
Q Consensus        91 d~E~~~~~y~l~v~a~D~-g~p~~~st~~i~i~~~  124 (127)
                      |||... .|.|.|.|+|. |.|+++++++++|+||
T Consensus        60 D~E~~~-~y~l~v~a~D~~~~~~~~~~~~V~I~V~   93 (93)
T PF00028_consen   60 DRETQS-SYQLTVRATDSGGSPPLSSTATVTINVL   93 (93)
T ss_dssp             CTTTTS-EEEEEEEEEETTTSSEEEEEEEEEEEEE
T ss_pred             CcccCC-EEEEEEEEEECCCCCCCEEEEEEEEEEC
Confidence            999999 99999999999 8999999999999997

Cadherin-mediated cell-cell junctions are formed as a result of interaction between extracellular domains of identical cadherins, which are located on the membranes of the neighbouring cells. The stability of these adhesive junctions is ensured by binding of the intracellular cadherin domain with the actin cytoskeleton. There are a number of different isoforms distributed in a tissue-specific manner in a wide variety of organisms. Cells containing different cadherins tend to segregate in vitro, while those that contain the same cadherins tend to preferentially aggregate together. This observation is linked to the finding that cadherin expression causes morphological changes involving the positional segregation of cells into layers, suggesting they may play an important role in the sorting of different cell types during morphogenesis, histogenesis and regeneration. They may also be involved in the regulation of tight and gap junctions, and in the control of intercellular spacing. Cadherins are evolutionary related to the desmogleins which are component of intercellular desmosome junctions involved in the interaction of plaque proteins. Structurally, cadherins comprise a number of domains: classically, these include a signal sequence; a propeptide of around 130 residues; a single transmembrane domain and five tandemly repeated extracellular cadherin domains, 4 of which are cadherin repeats, and the fifth contains 4 conserved cysteines and a N-terminal cytoplasmic domain []. However, proteins are designated as members of the broadly defined cadherin family if they have one or more cadherin repeats. A cadherin repeat is an independently folding sequence of approximately 110 amino acids that contains motifs with the conserved sequences DRE, DXNDNAPXF, and DXD. Crystal structures have revealed that multiple cadherin domains form Ca2+-dependent rod-like structures with a conserved Ca2+-binding pocket at the domain-domain interface. Cadherins depend on calcium for their function: calcium ions bind to specific residues in each cadherin repeat to ensure its proper folding, to confer rigidity upon the extracellular domain and is essential for cadherin adhesive function and for protection against protease digestion.; GO: 0005509 calcium ion binding, 0007156 homophilic cell adhesion, 0016020 membrane; PDB: 2A4E_A 2A4C_B 2O72_A 2QVI_A 1NCJ_A 3Q2W_A 3Q2N_A 3LNH_B 3LNI_A 3Q2L_A ....
>KOG4289|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 9e-06
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 2e-04
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 6e-04
2yst_A119 Solution Structure Of The Third Cadherin Domain Fro 6e-04
3ubh_A419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 7e-04
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 4/61 (6%)
Query: 2   NAPVFSDFVYQATVKENQPIGTLVITLKAADADPP--GMNSKISYSVRGGDGLGYFTIDN 59
           N P+F+  VY ATV E   +GT V+ + A DAD P  G ++K+ YS+    G  YF++++
Sbjct: 102 NEPIFTKDVYTATVPEMADVGTFVVQVTATDADDPTYGNSAKVVYSIL--QGQPYFSVES 159
Query: 60  E 60
           E
Sbjct: 160 E 160
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure
>pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 8e-23
2qvi_A 215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 9e-16
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 2e-22
3ppe_A 203 Vascular endothelial cadherin; extracellular cadhe 5e-13
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 2e-22
3mvs_A 210 Cadherin-23, otocadherin; adhesion, extracellular 4e-22
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 3e-20
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 1e-21
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 1e-17
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 1e-21
3lnd_A 207 CDH6 protein, cadherin 6; cell adhesion, cell memb 8e-15
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-21
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-18
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-16
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-12
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-06
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 6e-21
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 7e-19
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-16
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-10
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 4e-10
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 8e-07
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 9e-21
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-20
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 3e-19
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-16
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 3e-12
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-06
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 3e-20
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 3e-18
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 1e-13
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 3e-20
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 2e-15
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 4e-20
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-19
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 9e-08
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-20
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-19
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-15
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-13
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-05
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 8e-20
2a4e_A 215 Cadherin-11; dimer, calcium binding, cell adhesion 1e-15
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 5e-19
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 7e-19
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-18
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-11
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 6e-18
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 8e-13
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 5e-17
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 4e-15
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 4e-15
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 5e-15
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 5e-15
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 3e-13
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 7e-13
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 5e-12
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
 Score = 87.8 bits (218), Expect = 8e-23
 Identities = 35/124 (28%), Positives = 46/124 (37%), Gaps = 27/124 (21%)

Query: 2   NAPVFSDFVYQATVKENQPIGTLVITLKAADADPP-GMNSKISYSVRGG----DGLGYFT 56
           N P F   V+  +V E    GT V+T+ A DAD P  +N  + Y +            FT
Sbjct: 104 NRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFT 163

Query: 57  IDNE-GPLNHFRIVPTKIDPGTKKKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRET 115
           I+NE G +                    I V   LDRE     Y L ++A D    P   
Sbjct: 164 INNETGDI--------------------ITVAAGLDREKVQQ-YTLIIQATDMEGNPTYG 202

Query: 116 YKAT 119
              T
Sbjct: 203 LSNT 206
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.95
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.94
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.91
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.91
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.9
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.9
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.9
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.9
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.9
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.89
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.89
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.89
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.89
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.87
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 99.87
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.86
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.85
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.85
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.84
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.84
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.84
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.84
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.83
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.83
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.83
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.83
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.82
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.82
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.82
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.81
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.8
3mvs_A 210 Cadherin-23, otocadherin; adhesion, extracellular 99.8
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.78
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.77
2qvi_A 215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.73
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 99.73
2a4e_A 215 Cadherin-11; dimer, calcium binding, cell adhesion 99.72
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.69
3ppe_A 203 Vascular endothelial cadherin; extracellular cadhe 99.67
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.64
3lnd_A 207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.64
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.61
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.46
4apx_B 242 Protocadherin-15, otocadherin; cell adhesion, hear 99.11
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 93.6
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 93.15
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=8e-28  Score=158.62  Aligned_cols=103  Identities=31%  Similarity=0.440  Sum_probs=96.6

Q ss_pred             CCCCeeeCCeeEEEEeCCCCCCeEEEEEEEEeCCCCCCCCcEEEEEEeCCC--CCcEEEeCCCCeEEEeeeccccCCCCC
Q psy1047           1 MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDG--LGYFTIDNEGPLNHFRIVPTKIDPGTK   78 (127)
Q Consensus         1 ~N~P~F~~~~y~~~v~E~~~~g~~v~~~~a~D~D~~g~n~~i~y~i~~~~~--~~~F~i~~~tg~i~~~~~~~~~~~~~~   78 (127)
                      ||+|+|.+..|.+.|+|+.++|+.|+++.|+|+|. |.|+.|+|+|..+..  ..+|.|++.+|.|              
T Consensus         9 Dn~P~F~~~~y~~~v~En~~~Gt~v~~v~A~D~D~-g~n~~i~Y~i~~~~~~~~~~F~Id~~tG~I--------------   73 (119)
T 2yst_A            9 DNSPRFEKSVYEADLAENSAPGTPILQLRAADLDV-GVNGQIEYVFGAATESVRRLLRLDETSGWL--------------   73 (119)
T ss_dssp             CCCCCCSSSEEEEEEETTCCTTCEEEECCCCCSSS-SCCSCCCCEECSCCTTHHHHEEECTTTCEE--------------
T ss_pred             CCCCCcCCCcEEEEEECCCCCCCEEEEEEEEeCCC-CCCCeEEEEEecCCCccccEEEEeCCceEE--------------
Confidence            69999999999999999999999999999999999 999999999986543  4699999999999              


Q ss_pred             CceeeEEEccCCCCCCCCCeEEEEEEEEECCCCCcceeEEEEEEeEe
Q psy1047          79 KKEYNIVVLKLLDREIAPLGYNLTLRAVDKGTPPRETYKATPRNGLT  125 (127)
Q Consensus        79 ~~~~~l~~~~~ld~E~~~~~y~l~v~a~D~g~p~~~st~~i~i~~~~  125 (127)
                            .+.++||||... .|.|.|.|+|.|.|+++++++++|+++-
T Consensus        74 ------~~~~~LD~E~~~-~y~l~V~A~D~g~p~~s~~~~v~I~V~D  113 (119)
T 2yst_A           74 ------SVLHRIDREEVN-QLRFTVMARDRGQPPKTDKATVVLNIKD  113 (119)
T ss_dssp             ------EECSCCCTTTCS-EEEEEEEECCSBTTBCCEEEEEEEEEEC
T ss_pred             ------EECccCCcccCC-EEEEEEEEEECCCCCcEEEEEEEEEEEe
Confidence                  899999999999 9999999999999999999999999874
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 127
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 2e-12
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 7e-11
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 1e-10
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 3e-10
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 3e-09
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-07
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 3e-07
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 8e-07
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 7e-06
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score = 57.3 bits (137), Expect = 2e-12
 Identities = 23/85 (27%), Positives = 35/85 (41%), Gaps = 1/85 (1%)

Query: 2  NAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEG 61
          NAP+F    Y A V EN+  G  V  L   D D PG  +  +      +  G+F I  + 
Sbjct: 4  NAPIFDPKTYTALVPENEI-GFEVQRLSVTDLDMPGTPAWQAVYKIRVNEGGFFNITTDP 62

Query: 62 PLNHFRIVPTKIDPGTKKKEYNIVV 86
            N   +   K      +K+Y + +
Sbjct: 63 ESNQGILTTAKGLDFELRKQYVLQI 87
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.93
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.93
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.93
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.91
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.86
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.77
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.77
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.76
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.75
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.73
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 86.24
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=99.93  E-value=1.7e-26  Score=147.95  Aligned_cols=101  Identities=25%  Similarity=0.300  Sum_probs=94.1

Q ss_pred             CCCCeeeCCeeEEEEeCCCCCCeEEEEEEEEeCCCCCCCCcEEEEEEeCCCCCcEEEeCCCCeEEEeeeccccCCCCCCc
Q psy1047           1 MNAPVFSDFVYQATVKENQPIGTLVITLKAADADPPGMNSKISYSVRGGDGLGYFTIDNEGPLNHFRIVPTKIDPGTKKK   80 (127)
Q Consensus         1 ~N~P~F~~~~y~~~v~E~~~~g~~v~~~~a~D~D~~g~n~~i~y~i~~~~~~~~F~i~~~tg~i~~~~~~~~~~~~~~~~   80 (127)
                      ||+|+|.+..|.+.|+|+.++|+.|+++.|.|+|. +.|+.++|+|. ++..++|.|++.+|.|                
T Consensus         1 Dn~P~F~~~~~~~~v~E~~~~g~~v~~v~A~D~D~-~~~~~i~y~i~-~~~~~~F~id~~tG~i----------------   62 (107)
T d1l3wa4           1 NEAPFFVPAVSRVDVSEDLSRGEKIISLVAQDPDK-QQIQKLSYFIG-NDPARWLTVNKDNGIV----------------   62 (107)
T ss_dssp             CCCCEESSCEECCCBCTTCCSSEEEEECCEECCCT-TCCCCEEEEEC-CCSSCCCEEETTTTEE----------------
T ss_pred             CcCCCcCCCeEEEEEECCCCCCCEEEEeEEecCCc-CcCCceeEEec-CCCcccceeccccceE----------------
Confidence            79999999999999999999999999999999998 88999999997 4677899999999999                


Q ss_pred             eeeEEEccCCCCCC----CCCeEEEEEEEEECCCCCcceeEEEEEEeE
Q psy1047          81 EYNIVVLKLLDREI----APLGYNLTLRAVDKGTPPRETYKATPRNGL  124 (127)
Q Consensus        81 ~~~l~~~~~ld~E~----~~~~y~l~v~a~D~g~p~~~st~~i~i~~~  124 (127)
                          .+.+.||||.    .. .|.|.|+|+|.|.|++++++++.|+++
T Consensus        63 ----~~~~~lD~E~~~~~~~-~y~l~v~a~D~g~p~~~~t~~v~V~V~  105 (107)
T d1l3wa4          63 ----TGNGNLDRESEYVKNN-TYTVIMLVTDDGVSVGTGTGTLILHVL  105 (107)
T ss_dssp             ----EECSCCCTTSSSCCSS-CCEEEEEEEECSSSCCCCCEEEECCBC
T ss_pred             ----EEccccChhhccccCC-eEEEEEEEEECCcCCcEEEEEEEEEEE
Confidence                9999999995    35 699999999999999999999999875
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure