Diaphorina citri psyllid: psy10488


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460--
MNHNHIVDGPRPAQKDILAIRAYILLFLKQLMMLGPGVKEDELQSILNYLTTVQEDENLHDVLQTLISLMCDHPACLVPAFDMKQGVRTVFKLLTSQSQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLQHESSLSFATYNVLYEILTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQSELLLEVKKLFLSDLTLLCNNNRENRRTVLQMSVWQGMPIEVAVSFLQRLVNMADVLVFASSLNFAELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERHRALLNSPAYNNPTKNAHLQSLIRGAQTSPKNANDVPGGPTSSSSPVKDLHKLLQDMDVNRLRAAIYRDMEESKQAQFLSLAVVYFISVLMVSKYRDILEPPPMLPRALSPPLTQNNNQGHEGKWVYFISVLMVSKYRDILEPPPMLPRALSPPLTQNNNQGHE
ccccEEEccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHEEcccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccc
MNHNHIVDGPRPAQKDILAIRAYILLFLKQLMMLGPGVKEDELQSILNYLTTVQEDENLHDVLQTLISLMCDHPACLVPAFDMKQGVRTVFKLLTSQSQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLQHESSLSFATYNVLYEILTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQSELLLEVKKLFLSDLTLLCNNNRENRRTVLQMSVWQGMPIEVAVSFLQRLVNMADVLVFASSLNFAELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERH********************************************PVKDLHKLLQDMDVNRLRAAIYRDMEESKQAQFLSLAVVYFISVLMVSKYRDIL**********************EGKWVYFISVLMVSKYRDILEPPPMLPRALSP***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHNHIVDGPRPAQKDILAIRAYILLFLKQLMMLGPGVKEDELQSILNYLTTVQEDENLHDVLQTLISLMCDHPACLVPAFDMKQGVRTVFKLLTSQSQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLQHESSLSFATYNVLYEILTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQSELLLEVKKLFLSDLTLLCNNNRENRRTVLQMSVWQGMPIEVAVSFLQRLVNMADVLVFASSLNFAELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERHRALLNSPAYNNPTKNAHLQSLIRGAQTSPKNANDVPGGPTSSSSPVKDLHKLLQDMDVNRLRAAIYRDMEESKQAQFLSLAVVYFISVLMVSKYRDILEPPPMLPRALSPPLTQNNNQGHEGKWVYFISVLMVSKYRDILEPPPMLPRALSPPLTQNNNQGHE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neurobeachin Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins. Required for correct retinal pattern formation and may function in cell fate determination through its interactions with the EGFR and Notch signaling pathways.confidentQ9W4E2
Neurobeachin Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins. May have a role in membrane trafficking.confidentQ9EPN1
Neurobeachin Binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. May anchor the kinase to cytoskeletal and/or organelle-associated proteins.confidentQ8NFP9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007528 [BP]neuromuscular junction developmentprobableGO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0042675 [BP]compound eye cone cell differentiationprobableGO:0048749, GO:0032502, GO:0009887, GO:0009653, GO:0044707, GO:0007423, GO:0048869, GO:0048592, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0001654, GO:0009987, GO:0001745, GO:0032501, GO:0007275, GO:0044699, GO:0048856
GO:0016319 [BP]mushroom body developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0008355 [BP]olfactory learningprobableGO:0032501, GO:0007635, GO:0044707, GO:0042048, GO:0044708, GO:0050896, GO:0007612, GO:0007610, GO:0007611, GO:0008306, GO:0008150, GO:0050890, GO:0050877, GO:0042221, GO:0044699, GO:0003008
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GRL, chain A
Confidence level:probable
Coverage over the Query: 20-285
View the alignment between query and template
View the model in PyMOL