Diaphorina citri psyllid: psy10506

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----

MHRIYGPPNPDTVPDDGKLKSEVMVKDNRRYYLDLKENTRGRFLRTADVNLLIIYEQDKQGQQQQEQELATKMLQIQSKRFYLDVKQNRRGRFIKVNNIPIAICLNCQQQQEQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEVGADGRRSQIFLALSVAEQFRGHLSAFSDYYASLGPPNPDTVPDDGKLKSEVMVKDNRRYYLDLKENTRGRFLRVSQTIPRGGPRSQIAIPAQGMIEFRDALTDLLEEFGTEDGGYKVLSLVPHQVSQTIPRGGPRSQIAIPAQGMIEFRDALTDLLEEFGTEDGGYKGELPEGRHMRVENKNFYFDIGQNNRGIYMRVSEVSQTIPRGGPRSQIAIPAQGMIEFRDALTDLLEEFGTEDGGYKGELPEGRHMRVENKNFYFDIGQNNRGIYMRVSEHYYIIPFDSLVVDQ

ccccccccccccccccccccccEEEEcccEEEEEccccccccEEEEEEEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHcEEEEEcEEEEEEEcccccEEEEEEEEEcccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccEEEEEccccccccEEEEEEEccccccccEEEEcHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHcccccccccccccccEEEEcccEEEEEccccccccEEEEEEECccccccccccEEEEcHHHHHHHHHHHHHHHHHHccccccccccccccccEEEcccEEEEEccccccccEEEEEEcEEECccccEECcc

***********************MVKDNRRYYLDLKENTRGRFLRTADVNLLIIYE***************KMLQIQSKRFYLDVKQNRRGRFIKVNNIPIAICLNCQQQQEQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEVGADGRRSQIFLALSVAEQFRGHLSAFSDYYASL*******************VKDNRRYYLDLKENTRGRFLRVSQTIP*****SQIAIPAQGMIEFRDALTDLLEEFGTEDGGYKV*******************QIAIPAQGMIEFRDALTDLLEEFGTEDGGYKG*****RHMRVENKNFYFDIGQNNRGIYMRVSEVSQTI**GGPRSQIAIPAQGMIEFRDALTDLLEEFGTED**YKGEL**GRHMRVENKNFYFDIGQNNRGIYMRVSEHYYIIPFDSLVVDQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006268 [BP]	DNA unwinding involved in replication	probable	GO:0071103, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0032392, GO:0006139, GO:0032508, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0032422 [MF]	purine-rich negative regulatory element binding	probable	GO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0046332 [MF]	SMAD binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005662 [CC]	DNA replication factor A complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0030894, GO:0032991, GO:0043231, GO:0043234, GO:0043601, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000900 [MF]	translation repressor activity, nucleic acid binding	probable	GO:0090079, GO:0003676, GO:0097159, GO:0030371, GO:0003674, GO:0005488, GO:0045182, GO:1901363
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0031935 [BP]	regulation of chromatin silencing	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468, GO:0060968
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003697 [MF]	single-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003691 [MF]	double-stranded telomeric DNA binding	probable	GO:0043565, GO:0043566, GO:0042162, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003690, GO:0097159, GO:1901363
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0017148 [BP]	negative regulation of translation	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0006417, GO:0010558, GO:0048523
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K44, chain A
Confidence level:very confident
Coverage over the Query: 112-255
View the alignment between query and template
View the model in PyMOL

Template: 3K44, chain A
Confidence level:very confident
Coverage over the Query: 189-268,281-287,308-382
View the alignment between query and template
View the model in PyMOL