Diaphorina citri psyllid: psy10508

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-----
MLDSFQLNFDKSQLNVVSDKYALYKPTCDYDKKSALEQSIRQYLLKLIKTPDIDIKVIENYISLCVELCMKDMCNSTLPIILLSDTFDMSTLDKCEQLFYYVEVNVNIWKQQTFFMSCKNNLLRMCNDLLRRLSRSQNTVFCGRILLFLAKFFPFSERSGLNIISEFNVENITEFGGDEEMDVSSNETEETDTEEVDKVKIDFNFYKKFWSLQDYFRNPVQCYNKVSWKMFTSYAETVLAAFKSYKLDDVQSSLNPSGDYFAKYLTNQKLLDLQLSDTNFRRYVLLQFLILFQYFTSTVKSRGEGLELKSDQEKWVKDTTETVYSLIKQTPPDGEHFSQVVKLILKGEEHWNQWKNEGCPELKRPLTSITDEDKKDEPDAKKKKTPELTKLWNSKDNLEACKSAERDFTPSLESYFEEAIQQMDPAAAVEEQYKKVNDSNYAWRALRLLSRKCPHFFLNATPNVEKNSEFIENMVKRCVKEKPSSQISGNGNGVDQDPAEVEVDTKSEEIQEEEKEEDWEAKADPEGDADEVMSVEYCYQRNWHKQAVTSFIIGI
cHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHcccccccHHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
**DSFQLNFDKSQLNVVSDKYALYKPTCDYDKKSALEQSIRQYLLKLIKTPDIDIKVIENYISLCVELCMKDMCNSTLPIILLSDTFDMSTLDKCEQLFYYVEVNVNIWKQQTFFMSCKNNLLRMCNDLLRRLSRSQNTVFCGRILLFLAKFFPFSERSGLNIISEFNVENITEF**********************KVKIDFNFYKKFWSLQDYFRNPVQCYNKVSWKMFTSYAETVLAAFKSYKLD********SGDYFAKYLTNQKLLDLQLSDTNFRRYVLLQFLILFQYFTSTVKSR***********KWVKDTTETVYSLIKQTPPDGEHFSQVVKLILKGEEHWNQWKNEGCPEL*******************************************RDFTPSLESYFEE************EQYKKVNDSNYAWRALRLLSRKCPHFFLNATPNVEKNSEFIENMVK*******************************************************VMSVEYCYQRNWHKQAVTSFIIGI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDSFQLNFDKSQLNVVSDKYALYKPTCDYDKKSALEQSIRQYLLKLIKTPDIDIKVIENYISLCVELCMKDMCNSTLPIILLSDTFDMSTLDKCEQLFYYVEVNVNIWKQQTFFMSCKNNLLRMCNDLLRRLSRSQNTVFCGRILLFLAKFFPFSERSGLNIISEFNVENITEFGGDEEMDVSSNETEETDTEEVDKVKIDFNFYKKFWSLQDYFRNPVQCYNKVSWKMFTSYAETVLAAFKSYKLDDVQSSLNPSGDYFAKYLTNQKLLDLQLSDTNFRRYVLLQFLILFQYFTSTVKSRGEGLELKSDQEKWVKDTTETVYSLIKQTPPDGEHFSQVVKLILKGEEHWNQWKNEGCPELKRPLTSITDEDKKDEPDAKKKKTPELTKLWNSKDNLEACKSAERDFTPSLESYFEEAIQQMDPAAAVEEQYKKVNDSNYAWRALRLLSRKCPHFFLNATPNVEKNSEFIENMVKRCVKEKPSSQISGNGNGVDQDPAEVEVDTKSEEIQEEEKEEDWEAKADPEGDADEVMSVEYCYQRNWHKQAVTSFIIGI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
THO complex subunit 1 Regulates transcriptional elongation of a subset of genes. Participates in an apoptotic pathway which is characterized by activation of caspase-6, increases in the expression of BAK1 and BCL2L1 and activation of NF-kappa-B. This pathway does not require p53/TP53, nor does the presence of p53/TP53 affect the efficiency of cell killing. Activates a G2/M cell cycle checkpoint prior to the onset of apoptosis. Apoptosis is inhibited by association with RB1 (By similarity). Essential for early embryonic development. Required for normal gene expression during postnatal testis development.confidentQ8R3N6
THO complex subunit 1 Regulates transcriptional elongation of a subset of genes. Participates in an apoptotic pathway which is characterized by activation of caspase-6, increases in the expression of BAK1 and BCL2L1 and activation of NF-kappa-B. This pathway does not require p53/TP53, nor does the presence of p53/TP53 affect the efficiency of cell killing. Activates a G2/M cell cycle checkpoint prior to the onset of apoptosis. Apoptosis is inhibited by association with RB1.confidentQ96FV9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!