Diaphorina citri psyllid: psy10512


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MPSDAKKKQQQKKKEQAKGRGAAAPKKPTTSATNDVKPEQITNGVKQEPEEISPEEALCRKLEADAKLNAEARACTGSLAVHPKSRDVKIANFSITFHGCELLQDTMLELNCGRRYGLLGLNGSGKSTLLAVLGNREVPVPDHIDIFHLTREMPASDKSALTCVMEVDEERVRLEKLAEQLVACEDDESQEQLMDIYDRLDDISADTAEARAANILHGLGFTKEMQQKKTKDFSGGWRMRIALARALYVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVIISHSQDFLNGVCTNIIHLDKRKLKYYGGNYEAFCKTRLELLENQMKQYNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLAKMVNQGLTDKVTTDKTVTFTFPSCGKIPPPVIMVQNVSFRYSDDGPWIYRNLEFGIDLDTRLALVGPNGAGKSTLLNLIYGDLTPSVGMVRKNSHLRFARYHQHLHELLDLDISPLDYMLQSFPEVKDREEMRKIIGRYGLTGRQQVCPIRQLSDGQKCRVVFAYLAWQAPHLLLLDEPTNHLDMETIDALADAINDFEGGLVLVSHDFRLINQVAEEIWICENGKVTKWEGNILDYKETLRAKVLKEKNKSAAVSNGKKK
cccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEccEEcccccEEEECcccEEEEEccccccHHHHHHHHcccccccccccEEEEECcccccccccHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccEEEEEEccccHHHHHHcEEEEEccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccEEEEccccccccccEEEEEEEEEECccccccCEEccEEcccccccEEEEccccccHHHHHHHHccccccccEEEEEccccEEEEEcccccccccccccHHHHHHHHccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEECccCEEECcccHHHHHHHHHHHHHHHHHHHHHHHHcccc
**************************************************************************CTGSLAVHPKSRDVKIANFSITFHGCELLQDTMLELNCGRRYGLLGLNGSGKSTLLAVLGNREVPVPDHIDIFHLTREMPASDKSALTCVMEVDEERVRLEKLAEQLVACE******QLMDIYDRLDDISADTAEARAANILHGLGFTKEMQQKKTKDFSGGWRMRIALARALYVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVIISHSQDFLNGVCTNIIHLDKRKLKYYGGNYEAFCKTRLELLENQMKQYNWEQDQIAHMKNYIARFGHG*****************MVNQGLTDKVTTDKTVTFTFPSCGKIPPPVIMVQNVSFRYSDDGPWIYRNLEFGIDLDTRLALVGPNGAGKSTLLNLIYGDLTPSVGMVRKNSHLRFARYHQHLHELLDLDISPLDYMLQSFPEVKDREEMRKIIGRYGLTGRQQVCPIRQLSDGQKCRVVFAYLAWQAPHLLLLDEPTNHLDMETIDALADAINDFEGGLVLVSHDFRLINQVAEEIWICENGKVTKWEGNILDYKETLRAKV****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSDAKKKQQQKKKEQAKGRGAAAPKKPTTSATNDVKPEQITNGVKQEPEEISPEEALCRKLEADAKLNAEARACTGSLAVHPKSRDVKIANFSITFHGCELLQDTMLELNCGRRYGLLGLNGSGKSTLLAVLGNREVPVPDHIDIFHLTREMPASDKSALTCVMExxxxxxxxxxxxxxxxxxxxxESQEQLMDIYDRLDDISADTAEARAANILHGLGFTKEMQQKKTKDFSGGWRMRIALARALYVKPHLLLLDEPTNHLDLDACVWLEEELKTYKRILVIISHSQDFLNGVCTNIIHLDKRKLKYYGGNYEAFCKTRLELLENQMKQYNWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLAKMVNQGLTDKVTTDKTVTFTFPSCGKIPPPVIMVQNVSFRYSDDGPWIYRNLEFGIDLDTRLALVGPNGAGKSTLLNLIYGDLTPSVGMVRKNSHLRFARYHQHLHELLDLDISPLDYMLQSFPEVKDREEMRKIIGRYGLTGRQQVCPIRQLSDGQKCRVVFAYLAWQAPHLLLLDEPTNHLDMETIDALADAINDFEGGLVLVSHDFRLINQVAEEIWICENGKVTKWEGNILDYKETLRAKVLKEKNKSAAVSNGKKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-binding cassette sub-family F member 2 very confidentQ2KJA2
ABC transporter ATP-binding protein ARB1 Stimulates 40S and 60S ribosome biogenesis.very confidentP40024
ATP-binding cassette sub-family F member 2 very confidentQ99LE6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]biological_processconfident
GO:0032991 [CC]macromolecular complexconfidentGO:0005575
GO:0000056 [BP]ribosomal small subunit export from nucleusprobableGO:0051169, GO:0051168, GO:0033750, GO:0033753, GO:0071166, GO:0051656, GO:0071840, GO:0042254, GO:0044699, GO:0022613, GO:0016482, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0071426, GO:0046907, GO:0071428, GO:0000054, GO:0044085, GO:0008150
GO:0035690 [BP]cellular response to drugprobableGO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042626 [MF]ATPase activity, coupled to transmembrane movement of substancesprobableGO:0016787, GO:0016818, GO:0016820, GO:0042623, GO:0005215, GO:0043492, GO:0016817, GO:0003824, GO:0017111, GO:0015399, GO:0022857, GO:0003674, GO:0016887, GO:0016462, GO:0015405, GO:0022804
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005740 [CC]mitochondrial envelopeprobableGO:0031967, GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0031975, GO:0044446, GO:0044444, GO:0044429, GO:0005575, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0043190 [CC]ATP-binding cassette (ABC) transporter complexprobableGO:0043234, GO:0044425, GO:0016020, GO:0032991, GO:0005575
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0008494 [MF]translation activator activityprobableGO:0090079, GO:0045182, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363
GO:0009409 [BP]response to coldprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042788 [CC]polysomal ribosomeprobableGO:0005737, GO:0005844, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0042624 [MF]ATPase activity, uncoupledprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0016887
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006007 [BP]glucose catabolic processprobableGO:0071704, GO:0019320, GO:1901575, GO:0005975, GO:0044238, GO:0046365, GO:0005996, GO:0019318, GO:0016052, GO:0008150, GO:0008152, GO:0044723, GO:0006006, GO:0009056, GO:0044724
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0019243 [BP]methylglyoxal catabolic process to D-lactateprobableGO:1901575, GO:0046185, GO:0006081, GO:0006082, GO:0009056, GO:0009987, GO:0006089, GO:0019752, GO:0032787, GO:0044248, GO:0071704, GO:0044710, GO:0051596, GO:0044237, GO:0008152, GO:0043436, GO:0008150, GO:0009438, GO:0044281, GO:1901615
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0045727 [BP]positive regulation of translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 398-607
View the alignment between query and template
View the model in PyMOL
Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 86-155,183-323,346-352,370-594
View the alignment between query and template
View the model in PyMOL
Template: 3TUI, chain C
Confidence level:very confident
Coverage over the Query: 87-317
View the alignment between query and template
View the model in PyMOL
Template: 3J16, chain B
Confidence level:very confident
Coverage over the Query: 92-327,341-351,372-608
View the alignment between query and template
View the model in PyMOL
Template: 2IWH, chain A
Confidence level:confident
Coverage over the Query: 93-148,168-369,402-502
View the alignment between query and template
View the model in PyMOL