Diaphorina citri psyllid: psy10513

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MSSDCKGSSNDPPPKKDKPKCESTRHEPTKENKPCKETKPKSKKSSEPTQSSQHSPDSLGKTERQTLQNFHEDCIDKINTQINDEIRSAYTYISMASFCTQDNVALFGFAKFFTHSYKEEIEHMEHLIAYLNKRGGQLRLTSIEAPSKQEWNTVEDLLTEALHMEKQLNEKLLKLHACASQHGDANLTDFLEGRYLQEQVDAIKTLADLLTTVRRTQLYLVDRDLMSGKFSMHGNDNGE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccCEECcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
****************************************************************QTLQNFHEDCIDKINTQINDEIRSAYTYISMASFCTQDNVALFGFAKFFTHSYKEEIEHMEHLIAYLNKRGGQLRLTSIEAPSKQEWNTVEDLLTEALHMEKQLNEKLLKLHACASQHGDANLTDFLEGRYLQEQVDAIKTLADLLTTVRRTQLYLVDRDLM*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDCKGSSNDPPPKKDKPKCESTRHEPTKENKPCKETKPKSKKSSEPTQSSQHSPDSLGKTERQTLQNFHEDCIDKINTQINDEIRSAYTYISMASFCTQDNVALFGFAKFFTHSYKEEIEHMEHLIAYLNKRGGQLRLTSIEAPSKQEWNTVEDLLTEALHMEKQLNEKLLKLHACASQHGDANLTDFLEGRYLQEQVDAIKTLADLLTTVRRTQLYLVDRDLMSGKFSMHGNDNGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentP09528
Ferritin-1, chloroplastic Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.confidentP19976
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentQ95MP7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048147 [BP]negative regulation of fibroblast proliferationprobableGO:0042127, GO:0008285, GO:0048145, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051353 [BP]positive regulation of oxidoreductase activityprobableGO:0051341, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0051347 [BP]positive regulation of transferase activityprobableGO:0019222, GO:0050790, GO:0051338, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0051349 [BP]positive regulation of lyase activityprobableGO:0019222, GO:0050790, GO:0051339, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0006880 [BP]intracellular sequestering of iron ionprobableGO:0050801, GO:0051238, GO:0042592, GO:0055072, GO:0051651, GO:0051235, GO:0044699, GO:0065007, GO:0065008, GO:0019725, GO:0006879, GO:0006875, GO:0009987, GO:0006873, GO:0044763, GO:0030003, GO:0055065, GO:0055080, GO:0055082, GO:0051179, GO:0051641, GO:0048878, GO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008043 [CC]intracellular ferritin complexprobableGO:0043234, GO:0070288, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.16.-.-Oxidizing metal ions.probable
1.16.3.-With oxygen as acceptor.probable
1.16.3.1Ferroxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RCD, chain A
Confidence level:very confident
Coverage over the Query: 64-227
View the alignment between query and template
View the model in PyMOL
Template: 3A68, chain A
Confidence level:very confident
Coverage over the Query: 31-45,56-228
View the alignment between query and template
View the model in PyMOL