Diaphorina citri psyllid: psy10547


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVTPYWR
ccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEECccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHcHHHcccEEEccccccccccHHHHcccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccEEEcccccccccccccc
*****SPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVTPYW*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVTPYWR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0002682 [BP]regulation of immune system processprobableGO:0008150, GO:0065007, GO:0050789
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:1901681 [MF]sulfur compound bindingprobableGO:0003674, GO:0005488
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 69-266
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:very confident
Coverage over the Query: 41-123,137-263
View the alignment between query and template
View the model in PyMOL
Template: 3G06, chain A
Confidence level:very confident
Coverage over the Query: 22-267
View the alignment between query and template
View the model in PyMOL