Psyllid ID: psy10547


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVTPYWR
ccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHcHHHcccEEEccccccccccHHHHcccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccEEEcccccccccccccc
cccccccccEEccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccHHHcccccccEEEcccccccEcccHHcccccEEEEEcccccccEcccHHHccHHHHccccHHHccccccEEEEcccccccEcccHHHcccccccEEEEccccccccccHHHHHccHcccEEEccccccccccHHHHcccHcHcEEEcccccccccHHHHccHHHccEEEcccccHHHccHHHHEEEcccccccccccccc
MTSHFSPFHLVTLILLTALIqggsaqcpwedeseselqSTCICSYNTANELSiqcndltnyplFKATlnkhvntkvPLDLLYINNSAIrninentfngifiknlqlshcrinsitpnaFRHLDAIRNInentfngifiknlqlshcrinsitpnaFRHLEFTLKHLNlqendleqvpVETLRHLknltlidlsknkigkipddsfstLNNLVTLklsdnnltlyKNSFRGLELNNNLTLYKNSFRGLELSLKNlnlkntklksvtpywr
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNltlidlsknkigkipddsfSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELslknlnlkntklksvtpywr
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGlelslknlnlkntklkSVTPYWR
*****SPFHLVTLILLTALIQGGSAQCPWED****ELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTK*********
*****SP*HLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVTPYW*
MTSHFSPFHLVTLILLTALIQGG***************STCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVTPYWR
****FSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSHFSPFHLVTLILLTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLNLKNTKLKSVTPYWR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q86UN3 420 Reticulon-4 receptor-like yes N/A 0.724 0.464 0.290 8e-12
Q9BZR6 473 Reticulon-4 receptor OS=H no N/A 0.680 0.386 0.268 1e-11
O75473 907 Leucine-rich repeat-conta no N/A 0.769 0.228 0.285 1e-11
Q99M75 473 Reticulon-4 receptor OS=R yes N/A 0.546 0.310 0.307 2e-11
Q99PI8 473 Reticulon-4 receptor OS=M yes N/A 0.546 0.310 0.307 3e-11
Q80WD1 420 Reticulon-4 receptor-like no N/A 0.724 0.464 0.286 3e-11
Q7M6Z0 420 Reticulon-4 receptor-like no N/A 0.724 0.464 0.286 5e-11
Q9N0E3 473 Reticulon-4 receptor OS=M N/A N/A 0.457 0.260 0.325 1e-10
A4IIW9 606 Leucine-rich repeat and i no N/A 0.431 0.191 0.369 2e-10
P35859 603 Insulin-like growth facto no N/A 0.676 0.301 0.282 3e-10
>sp|Q86UN3|R4RL2_HUMAN Reticulon-4 receptor-like 2 OS=Homo sapiens GN=RTN4RL2 PE=1 SV=1 Back     alignment and function desciption
 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 108/220 (49%), Gaps = 25/220 (11%)

Query: 41  CICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIF 100
           C C Y++   +S Q N+ ++ PL      +          L++ N+ IR +   TF G  
Sbjct: 35  CTC-YSSPPTVSCQANNFSSVPLSLPPSTQR---------LFLQNNLIRTLRPGTF-GSN 83

Query: 101 IKNLQLSHCRINSITPNAFRHLDAI-----------RNINENTFNGI-FIKNLQLSHCRI 148
           +  L L    +++I P  FRHL A+           R++  +TF G+  +++L L  C++
Sbjct: 84  LLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQL 143

Query: 149 NSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTL 208
           +S+  N FR L  +L++L LQEN L  +  +    L NL+ + L  N++  + +  F  L
Sbjct: 144 SSLPGNIFRGL-VSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGL 202

Query: 209 NNLVTLKLSDNNL-TLYKNSFRGLELNNNLTLYKNSFRGL 247
            +L  L L  N L  +++ +FRGL     L L+ NS   L
Sbjct: 203 GSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLASL 242




May play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
Homo sapiens (taxid: 9606)
>sp|Q9BZR6|RTN4R_HUMAN Reticulon-4 receptor OS=Homo sapiens GN=RTN4R PE=1 SV=1 Back     alignment and function description
>sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=2 SV=1 Back     alignment and function description
>sp|Q99M75|RTN4R_RAT Reticulon-4 receptor OS=Rattus norvegicus GN=Rtn4r PE=1 SV=2 Back     alignment and function description
>sp|Q99PI8|RTN4R_MOUSE Reticulon-4 receptor OS=Mus musculus GN=Rtn4r PE=2 SV=1 Back     alignment and function description
>sp|Q80WD1|R4RL2_RAT Reticulon-4 receptor-like 2 OS=Rattus norvegicus GN=Rtn4rl2 PE=2 SV=1 Back     alignment and function description
>sp|Q7M6Z0|R4RL2_MOUSE Reticulon-4 receptor-like 2 OS=Mus musculus GN=Rtn4rl2 PE=2 SV=1 Back     alignment and function description
>sp|Q9N0E3|RTN4R_MACFA Reticulon-4 receptor OS=Macaca fascicularis GN=RTN4R PE=2 SV=1 Back     alignment and function description
>sp|A4IIW9|LIGO1_XENTR Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Xenopus tropicalis GN=lingo1 PE=2 SV=1 Back     alignment and function description
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
270007619 847 hypothetical protein TcasGA2_TC014301 [T 0.717 0.227 0.445 2e-42
340712482 891 PREDICTED: hypothetical protein LOC10064 0.747 0.225 0.402 2e-36
442625199 981 hattifattener, isoform B [Drosophila mel 0.684 0.187 0.395 2e-36
442625201 982 hattifattener, isoform C [Drosophila mel 0.684 0.187 0.395 2e-36
158297416 961 AGAP007846-PA [Anopheles gambiae str. PE 0.728 0.203 0.384 5e-36
357625849 852 hypothetical protein KGM_00882 [Danaus p 0.721 0.227 0.406 7e-36
350399820 891 PREDICTED: hypothetical protein LOC10074 0.743 0.224 0.397 1e-35
195470519 1342 GE17637 [Drosophila yakuba] gi|194173655 0.684 0.137 0.408 1e-35
194762211 1270 GF15849 [Drosophila ananassae] gi|190616 0.702 0.148 0.383 2e-35
242015296 941 leucine-rich transmembrane protein, puta 0.728 0.208 0.417 2e-35
>gi|270007619|gb|EFA04067.1| hypothetical protein TcasGA2_TC014301 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 145/249 (58%), Gaps = 56/249 (22%)

Query: 16  LTALIQGGSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTK 75
             ALI   SAQCPW+ ES  +LQS+C+CSYN  +ELS+QC D+ ++P   A L K+  T 
Sbjct: 10  FVALITLASAQCPWQRES-VDLQSSCLCSYNLGHELSVQC-DMVDWPKLLAALQKYA-TA 66

Query: 76  VPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNG 135
            PLDLLY+NNS I  +N+N    IF+ NL+                              
Sbjct: 67  TPLDLLYVNNSTIGALNDN----IFV-NLR------------------------------ 91

Query: 136 IFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKN 195
             + NLQLS C+INS+    F+  E  LK+LNLQ+NDL +VPVE+LR L+ L+L+DLS N
Sbjct: 92  --VHNLQLSGCKINSVAGGTFKGQEQHLKNLNLQDNDLTEVPVESLRPLRTLSLLDLSHN 149

Query: 196 KIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNSFRGLELNNNLTLYKNSFRGLELSLKNLN 255
           +I  +PD +F TL  L TLKLSDNN+TL       LE          + +GLE SLKNLN
Sbjct: 150 RISAVPDGAFETLKKLATLKLSDNNVTL------SLE----------ALKGLEGSLKNLN 193

Query: 256 LKNTKLKSV 264
           LK T+ K +
Sbjct: 194 LKGTRQKDI 202




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340712482|ref|XP_003394788.1| PREDICTED: hypothetical protein LOC100645748 [Bombus terrestris] Back     alignment and taxonomy information
>gi|442625199|ref|NP_001259873.1| hattifattener, isoform B [Drosophila melanogaster] gi|442625203|ref|NP_001259874.1| hattifattener, isoform D [Drosophila melanogaster] gi|440213133|gb|AGB92410.1| hattifattener, isoform B [Drosophila melanogaster] gi|440213135|gb|AGB92411.1| hattifattener, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442625201|ref|NP_608607.2| hattifattener, isoform C [Drosophila melanogaster] gi|442625205|ref|NP_001259875.1| hattifattener, isoform E [Drosophila melanogaster] gi|440213134|gb|AAF51357.2| hattifattener, isoform C [Drosophila melanogaster] gi|440213136|gb|AGB92412.1| hattifattener, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|158297416|ref|XP_317652.4| AGAP007846-PA [Anopheles gambiae str. PEST] gi|157015184|gb|EAA12609.4| AGAP007846-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357625849|gb|EHJ76140.1| hypothetical protein KGM_00882 [Danaus plexippus] Back     alignment and taxonomy information
>gi|350399820|ref|XP_003485649.1| PREDICTED: hypothetical protein LOC100741088 [Bombus impatiens] Back     alignment and taxonomy information
>gi|195470519|ref|XP_002087554.1| GE17637 [Drosophila yakuba] gi|194173655|gb|EDW87266.1| GE17637 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194762211|ref|XP_001963249.1| GF15849 [Drosophila ananassae] gi|190616946|gb|EDV32470.1| GF15849 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|242015296|ref|XP_002428300.1| leucine-rich transmembrane protein, putative [Pediculus humanus corporis] gi|212512885|gb|EEB15562.1| leucine-rich transmembrane protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
FB|FBgn0261509 1316 haf "hattifattener" [Drosophil 0.858 0.175 0.319 2.5e-22
UNIPROTKB|Q86UN3 420 RTN4RL2 "Reticulon-4 receptor- 0.710 0.454 0.291 2.1e-14
RGD|727797 420 Rtn4rl2 "reticulon 4 receptor- 0.710 0.454 0.287 7.2e-14
MGI|MGI:2669796 420 Rtn4rl2 "reticulon 4 receptor- 0.710 0.454 0.287 7.2e-14
MGI|MGI:1341817 907 Lgr5 "leucine rich repeat cont 0.806 0.239 0.280 8.3e-14
RGD|1307733 907 Lgr5 "leucine rich repeat cont 0.806 0.239 0.280 1.3e-13
ZFIN|ZDB-GENE-041008-23342 fmoda "fibromodulin a" [Danio 0.736 0.578 0.271 3.3e-13
UNIPROTKB|F1NXL1306 RTN4RL2 "Uncharacterized prote 0.765 0.673 0.303 4.1e-13
UNIPROTKB|F1MT22 907 LGR5 "Uncharacterized protein" 0.806 0.239 0.284 7.2e-13
FB|FBgn0033250 470 CG14762 [Drosophila melanogast 0.613 0.351 0.337 7.9e-13
FB|FBgn0261509 haf "hattifattener" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 273 (101.2 bits), Expect = 2.5e-22, P = 2.5e-22
 Identities = 82/257 (31%), Positives = 129/257 (50%)

Query:     7 PFHLVTLILLTALIQG----GSAQCPWEDESESELQSTCICSYNTANELSIQCNDLTNYP 62
             P     L+LL  LI G      AQCPW+ +   +LQ++CIC+YN   ELS+QC D  ++ 
Sbjct:    11 PAATTPLLLLLPLILGRLHVAHAQCPWQRDVP-DLQTSCICAYNLGRELSVQC-DQVDFS 68

Query:    63 LFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIFIKNLQLSHCRINSITPNAFRHL 122
                A +N H   K P+DLLY+NNS I  + +  F+ + + NLQLS C I  I   AF+  
Sbjct:    69 QLLAAMNTHARLK-PVDLLYVNNSTISELPDAVFSNLSLHNLQLSSCGIQRIATGAFKGQ 127

Query:   123 DAI-RNIN--ENTFNGIFIKNLQ-LSHCRINSITPNAFRHLE---FT----LKHLNLQEN 171
             +++ RN+N  +N    + ++ L+ L    +  ++ N   H+    F     L  L L +N
Sbjct:   128 ESVLRNLNLQDNLLADVPVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLSTLKLNDN 187

Query:   172 DLEQVPVETLRHLK-NLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLYKNS--- 227
             ++  +     R L+ +L  ++L   K  K+P+ S   L +L  L LS N +     +   
Sbjct:   188 NVT-LASNAFRGLEQSLKNLNLKGTKQRKVPE-SIRGLKSLAFLDLSQNGIKELPGAGGI 245

Query:   228 --FRGLELNNNLTLYKN 242
               F GL+    L L +N
Sbjct:   246 RVFDGLDALTALNLERN 262


GO:0008045 "motor neuron axon guidance" evidence=IMP
UNIPROTKB|Q86UN3 RTN4RL2 "Reticulon-4 receptor-like 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|727797 Rtn4rl2 "reticulon 4 receptor-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2669796 Rtn4rl2 "reticulon 4 receptor-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1341817 Lgr5 "leucine rich repeat containing G protein coupled receptor 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307733 Lgr5 "leucine rich repeat containing G protein coupled receptor 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041008-23 fmoda "fibromodulin a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXL1 RTN4RL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MT22 LGR5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0033250 CG14762 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 49.5 bits (119), Expect = 2e-08
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 163 LKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNL 221
           LK L+L  N L  +P    + L NL ++DLS N +  I  ++FS L +L +L LS NNL
Sbjct: 2   LKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNNLTSISPEAFSGLPSLRSLDLSGNNL 60


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
KOG4194|consensus 873 99.91
KOG4237|consensus 498 99.91
KOG4194|consensus 873 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.83
KOG0444|consensus 1255 99.79
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.77
KOG0617|consensus264 99.75
KOG0444|consensus 1255 99.72
KOG0472|consensus 565 99.72
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
KOG4237|consensus 498 99.67
KOG0617|consensus264 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
KOG0472|consensus 565 99.63
KOG0618|consensus 1081 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.6
KOG0618|consensus 1081 99.51
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.39
KOG0532|consensus 722 99.38
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.36
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.33
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.31
KOG1259|consensus490 99.31
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.3
KOG0532|consensus 722 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
KOG1259|consensus490 99.16
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.15
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.03
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.96
KOG1909|consensus382 98.95
PLN03150623 hypothetical protein; Provisional 98.95
PLN03150623 hypothetical protein; Provisional 98.92
KOG3207|consensus 505 98.88
KOG0531|consensus 414 98.76
KOG0531|consensus 414 98.74
KOG1859|consensus 1096 98.69
KOG3207|consensus 505 98.68
KOG1909|consensus382 98.67
KOG1644|consensus233 98.48
KOG4579|consensus177 98.42
KOG1859|consensus 1096 98.4
KOG4579|consensus177 98.37
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.34
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.34
KOG1644|consensus233 98.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.24
KOG4658|consensus 889 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.14
PRK15386 426 type III secretion protein GogB; Provisional 98.09
KOG3665|consensus 699 98.04
KOG4658|consensus 889 97.98
PRK15386 426 type III secretion protein GogB; Provisional 97.97
KOG2123|consensus 388 97.7
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.63
KOG2982|consensus 418 97.35
KOG2120|consensus419 97.31
KOG2982|consensus 418 97.28
KOG3665|consensus 699 97.2
KOG2123|consensus 388 97.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.82
KOG2120|consensus419 96.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.44
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.41
KOG2739|consensus260 96.28
KOG2739|consensus260 96.07
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.25
smart0037026 LRR Leucine-rich repeats, outliers. 95.25
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.23
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 95.15
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.43
smart0037026 LRR Leucine-rich repeats, outliers. 94.43
KOG3864|consensus221 93.99
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 93.7
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.77
KOG0473|consensus 326 92.75
KOG0473|consensus 326 92.4
KOG4308|consensus 478 91.13
KOG3864|consensus221 89.23
KOG4308|consensus 478 88.09
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 87.3
>KOG4194|consensus Back     alignment and domain information
Probab=99.91  E-value=1.4e-24  Score=188.22  Aligned_cols=225  Identities=25%  Similarity=0.431  Sum_probs=155.2

Q ss_pred             ccCCcceeecCCCCceEEEecCCCCCchh-----hhhhhhcc------------------CCCCcccEEEecCCCccccC
Q psy10547         36 ELQSTCICSYNTANELSIQCNDLTNYPLF-----KATLNKHV------------------NTKVPLDLLYINNSAIRNIN   92 (269)
Q Consensus        36 ~~~~~C~C~~~~~~~~~v~C~~~~~~~~~-----~~~l~~~~------------------~~~~~l~~l~l~~~~i~~l~   92 (269)
                      .||+.|.|..     .-+.|.+ .+++.+     .+.+|...                  ....+|+.+++.+|.+..||
T Consensus        45 ~cpa~c~c~~-----~lldcs~-~~lea~~~~~l~g~lp~~t~~LdlsnNkl~~id~~~f~nl~nLq~v~l~~N~Lt~IP  118 (873)
T KOG4194|consen   45 ECPATCPCNT-----RLLDCSD-RELEAIDKSRLKGFLPSQTQTLDLSNNKLSHIDFEFFYNLPNLQEVNLNKNELTRIP  118 (873)
T ss_pred             cCCCcCCCCc-----eeeecCc-cccccccccccCCcCccceeeeeccccccccCcHHHHhcCCcceeeeeccchhhhcc
Confidence            6778999975     5677773 333332     33333332                  34455666666666666666


Q ss_pred             cCCCCCCcccEEEecCCCCcccCcccccCCccccccc----------cccccc-ccccEEEcCCCCCCccChhHHhhccc
Q psy10547         93 ENTFNGIFIKNLQLSHCRINSITPNAFRHLDAIRNIN----------ENTFNG-IFIKNLQLSHCRINSITPNAFRHLEF  161 (269)
Q Consensus        93 ~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~----------~~~~~~-~~L~~L~l~~n~i~~~~~~~~~~l~~  161 (269)
                      ...-..-.++.|++.+|.|+.+....++.++.|+.++          .+.|.. .++++|+|++|.|+.+..+.|..+. 
T Consensus       119 ~f~~~sghl~~L~L~~N~I~sv~se~L~~l~alrslDLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~F~~ln-  197 (873)
T KOG4194|consen  119 RFGHESGHLEKLDLRHNLISSVTSEELSALPALRSLDLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGHFDSLN-  197 (873)
T ss_pred             cccccccceeEEeeeccccccccHHHHHhHhhhhhhhhhhchhhcccCCCCCCCCCceEEeeccccccccccccccccc-
Confidence            5443333477777777777777777777777777554          222322 3677778888877777777777777 


Q ss_pred             cccEEEccCCCCCccChhhhcCCCCCCEEeccCCCC------------------------CCCCCCcccCCCCCCEEEcC
Q psy10547        162 TLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKI------------------------GKIPDDSFSTLNNLVTLKLS  217 (269)
Q Consensus       162 ~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~i------------------------~~i~~~~~~~l~~L~~L~L~  217 (269)
                      +|..|.|++|+++.++...|+.+++|+.|+|..|+|                        ..+.+++|..+.++++|+|+
T Consensus       198 sL~tlkLsrNrittLp~r~Fk~L~~L~~LdLnrN~irive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~  277 (873)
T KOG4194|consen  198 SLLTLKLSRNRITTLPQRSFKRLPKLESLDLNRNRIRIVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLE  277 (873)
T ss_pred             hheeeecccCcccccCHHHhhhcchhhhhhccccceeeehhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecc
Confidence            777777777777777766666666666555555554                        44556677777888888888


Q ss_pred             CCcccccc-ccccCcCCCceeeeccCcccccc-------cccceeecCCCCCCCCCCC
Q psy10547        218 DNNLTLYK-NSFRGLELNNNLTLYKNSFRGLE-------LSLKNLNLKNTKLKSVTPY  267 (269)
Q Consensus       218 ~n~l~~~p-~~~~~l~~L~~l~l~~n~~~~l~-------~~L~~L~l~~n~l~~~p~~  267 (269)
                      .|++..+. .++.+++.|+.|++++|++.++.       .+|++|||+.|+|++++++
T Consensus       278 ~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~~  335 (873)
T KOG4194|consen  278 TNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLDEG  335 (873)
T ss_pred             cchhhhhhcccccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCChh
Confidence            88888764 47888889999999999888753       5899999999999998875



>KOG4237|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-12
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-12
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 2e-12
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-09
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-08
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 6e-05
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-07
3zyn_A 321 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 7e-07
2o6q_A 270 Structural Diversity Of The Hagfish Variable Lympho 6e-04
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 9e-07
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 7e-06
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 2e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-05
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 5e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-05
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 1e-04
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 2e-04
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 3e-04
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 3e-04
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 3e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 4e-04
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure

Iteration: 1

Score = 69.7 bits (169), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 59/219 (26%), Positives = 109/219 (49%), Gaps = 34/219 (15%) Query: 27 CPWEDESESELQSTCICSYNTANELSIQCNDLTNYPL--FKATLNKHVNTKVPLDLLYIN 84 CP + LQ+ + + + + N +++ P F+A N L +L+++ Sbjct: 18 CP-----QQGLQAVPVGIPAASQRIFLHGNRISHVPAASFRACRN--------LTILWLH 64 Query: 85 NSAIRNINENTFNGI-FIKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIF-IKNLQ 142 ++ + I+ F G+ ++ L LS NA +R+++ TF+G+ + L Sbjct: 65 SNVLARIDAAAFTGLALLEQLDLSD--------NA-----QLRSVDPATFHGLGRLHTLH 111 Query: 143 LSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPD 202 L C + + P FR L L++L LQ+N L+ +P +T R L NLT + L N+I +P+ Sbjct: 112 LDRCGLQELGPGLFRGLA-ALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPE 170 Query: 203 DSFSTLNNLVTLKLSDNNLT-LYKNSFRGLELNNNLTLY 240 +F L++L L L N + ++ ++FR +L +TLY Sbjct: 171 RAFRGLHSLDRLLLHQNRVAHVHPHAFR--DLGRLMTLY 207
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-27
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-27
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-23
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-19
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-12
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-14
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-18
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-16
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-05
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-06
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-04
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
 Score =  108 bits (273), Expect = 1e-28
 Identities = 58/244 (23%), Positives = 100/244 (40%), Gaps = 37/244 (15%)

Query: 39  STCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDL--LYINNSAIRNINENTF 96
             C+C        S     L   P             +P     ++++ + I ++   +F
Sbjct: 4   GACVCYNEPKVTTSCPQQGLQAVP-----------VGIPAASQRIFLHGNRISHVPAASF 52

Query: 97  NGI-FIKNLQLSHCRINSITPNAFRHLDA-----------IRNINENTFNG-IFIKNLQL 143
                +  L L    +  I   AF  L             +R+++  TF+G   +  L L
Sbjct: 53  RACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHL 112

Query: 144 SHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDD 203
             C +  + P  FR L   L++L LQ+N L+ +P +T R L NLT + L  N+I  +P+ 
Sbjct: 113 DRCGLQELGPGLFRGLA-ALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPER 171

Query: 204 SFSTLNNLVTLKLSDNNLT-LYKNSFRGLE------LNNNL--TLYKNSFRGLELSLKNL 254
           +F  L++L  L L  N +  ++ ++FR L       L  N    L   +   L  +L+ L
Sbjct: 172 AFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLR-ALQYL 230

Query: 255 NLKN 258
            L +
Sbjct: 231 RLND 234


>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.94
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.92
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.92
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.88
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.87
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.86
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.81
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.8
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.6
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.6
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.59
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.41
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.23
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.94
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.57
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.49
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.47
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 89.53
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 83.52
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=2.4e-28  Score=216.03  Aligned_cols=220  Identities=27%  Similarity=0.394  Sum_probs=182.2

Q ss_pred             cccCCcceeecCCCCceEEEecCCCCCchhhhhhhhccCCCCcccEEEecCCCccccCcCCCCCCc-ccEEEecCCCCcc
Q psy10547         35 SELQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIF-IKNLQLSHCRINS  113 (269)
Q Consensus        35 ~~~~~~C~C~~~~~~~~~v~C~~~~~~~~~~~~l~~~~~~~~~l~~l~l~~~~i~~l~~~~~~~~~-L~~L~l~~n~l~~  113 (269)
                      ..||..|.|...   ...+.|. ..++..+|..++..      ++.|++++|.+..++...|.... |++|++++|.++.
T Consensus        33 ~~Cp~~C~C~~~---~~~v~c~-~~~l~~iP~~~~~~------l~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~  102 (440)
T 3zyj_A           33 QTCPSVCSCSNQ---FSKVICV-RKNLREVPDGISTN------TRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRT  102 (440)
T ss_dssp             CCCCSSSEECTT---SCEEECC-SCCCSSCCSCCCTT------CSEEECCSCCCCEECTTTTSSCSSCCEEECCSSCCCE
T ss_pred             ccCCCCCEeCCC---CCEEEeC-CCCcCcCCCCCCCC------CcEEEccCCcCCeeCHHHhhCCCCCCEEECCCCcCCc
Confidence            346688999743   2579998 45666666666543      59999999999999988888776 9999999999999


Q ss_pred             cCcccccCCccccccc--cccc--------cc-ccccEEEcCCCCCCccChhHHhhccccccEEEccC-CCCCccChhhh
Q psy10547        114 ITPNAFRHLDAIRNIN--ENTF--------NG-IFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQE-NDLEQVPVETL  181 (269)
Q Consensus       114 ~~~~~~~~l~~L~~l~--~~~~--------~~-~~L~~L~l~~n~i~~~~~~~~~~l~~~L~~L~l~~-n~l~~~~~~~~  181 (269)
                      +.+.+|.++++|++|+  .|.+        .+ .+|++|++++|.++.+.+..|..++ +|++|++++ +.+..+++..|
T Consensus       103 i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~~~~l~-~L~~L~l~~~~~l~~i~~~~~  181 (440)
T 3zyj_A          103 IEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIP-SLRRLDLGELKRLSYISEGAF  181 (440)
T ss_dssp             ECGGGGTTCSSCCEEECCSSCCSSCCTTTSCSCSSCCEEECCSCCCCEECTTTTTTCT-TCCEEECCCCTTCCEECTTTT
T ss_pred             cChhhccCCccCCEEECCCCcCCeeCHhHhhccccCceeeCCCCcccccCHHHhhhCc-ccCEeCCCCCCCcceeCcchh
Confidence            9999999999888765  2222        22 2789999999999998888888888 899999998 56777887788


Q ss_pred             cCCCCCCEEeccCCCCCCCCCCcccCCCCCCEEEcCCCccccc-cccccCcCCCceeeeccCcccccc-------cccce
Q psy10547        182 RHLKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLY-KNSFRGLELNNNLTLYKNSFRGLE-------LSLKN  253 (269)
Q Consensus       182 ~~l~~L~~L~l~~n~i~~i~~~~~~~l~~L~~L~L~~n~l~~~-p~~~~~l~~L~~l~l~~n~~~~l~-------~~L~~  253 (269)
                      ..+++|+.|++++|.++.++.  +..+++|+.|++++|.++.+ |..+..+++|+.|++++|.+.+++       ++|++
T Consensus       182 ~~l~~L~~L~L~~n~l~~~~~--~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~  259 (440)
T 3zyj_A          182 EGLSNLRYLNLAMCNLREIPN--LTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVE  259 (440)
T ss_dssp             TTCSSCCEEECTTSCCSSCCC--CTTCSSCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCCEECTTSSTTCTTCCE
T ss_pred             hcccccCeecCCCCcCccccc--cCCCcccCEEECCCCccCccChhhhccCccCCEEECCCCceeEEChhhhcCCCCCCE
Confidence            899999999999999998874  78889999999999999875 678999999999999999887653       48999


Q ss_pred             eecCCCCCCCCCCC
Q psy10547        254 LNLKNTKLKSVTPY  267 (269)
Q Consensus       254 L~l~~n~l~~~p~~  267 (269)
                      |+|++|+|+.+|+.
T Consensus       260 L~L~~N~l~~~~~~  273 (440)
T 3zyj_A          260 INLAHNNLTLLPHD  273 (440)
T ss_dssp             EECTTSCCCCCCTT
T ss_pred             EECCCCCCCccChh
Confidence            99999999998875



>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.3 bits (100), Expect = 2e-05
 Identities = 36/160 (22%), Positives = 67/160 (41%), Gaps = 14/160 (8%)

Query: 101 IKNLQLSHCRINSITPNAFRHLDAIRNINENTFNGIFI------------KNLQLSHCRI 148
            + + L   RI+ +   +FR    +  +  ++     I            +     + ++
Sbjct: 34  SQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQL 93

Query: 149 NSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRHLKNLTLIDLSKNKIGKIPDDSFSTL 208
            S+ P  F  L   L  L+L    L+++     R L  L  + L  N +  +PDD+F  L
Sbjct: 94  RSVDPATFHGL-GRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDL 152

Query: 209 NNLVTLKLSDNNL-TLYKNSFRGLELNNNLTLYKNSFRGL 247
            NL  L L  N + ++ + +FRGL   + L L++N    +
Sbjct: 153 GNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHV 192


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.68
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.56
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.28
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.19
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.14
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.14
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.03
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.47
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.44
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.89
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2.9e-27  Score=195.47  Aligned_cols=217  Identities=25%  Similarity=0.446  Sum_probs=183.8

Q ss_pred             cCCcceeecCCCCceEEEecCCCCCchhhhhhhhccCCCCcccEEEecCCCccccCcCCCCCCc-ccEEEecCCCCcccC
Q psy10547         37 LQSTCICSYNTANELSIQCNDLTNYPLFKATLNKHVNTKVPLDLLYINNSAIRNINENTFNGIF-IKNLQLSHCRINSIT  115 (269)
Q Consensus        37 ~~~~C~C~~~~~~~~~v~C~~~~~~~~~~~~l~~~~~~~~~l~~l~l~~~~i~~l~~~~~~~~~-L~~L~l~~n~l~~~~  115 (269)
                      ||.+|.|..  ..+..|.|.+ .++..+|..+|..      ++.|++++|.|..++...|.... |++|++++|++..+.
T Consensus         2 cp~~C~C~~--~~~~~v~c~~-~~L~~iP~~ip~~------~~~L~Ls~N~i~~i~~~~f~~l~~L~~L~ls~n~l~~i~   72 (284)
T d1ozna_           2 CPGACVCYN--EPKVTTSCPQ-QGLQAVPVGIPAA------SQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARID   72 (284)
T ss_dssp             CCTTCEEEC--SSSCEEECCS-SCCSSCCTTCCTT------CSEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCEEC
T ss_pred             cCCCCEEcC--CCCeEEEcCC-CCCCccCCCCCCC------CCEEECcCCcCCCCCHHHhhccccccccccccccccccc
Confidence            668899963  3356899984 4566666666654      49999999999999999998887 999999999999999


Q ss_pred             cccccCCccccccc-----------cccccc-ccccEEEcCCCCCCccChhHHhhccccccEEEccCCCCCccChhhhcC
Q psy10547        116 PNAFRHLDAIRNIN-----------ENTFNG-IFIKNLQLSHCRINSITPNAFRHLEFTLKHLNLQENDLEQVPVETLRH  183 (269)
Q Consensus       116 ~~~~~~l~~L~~l~-----------~~~~~~-~~L~~L~l~~n~i~~~~~~~~~~l~~~L~~L~l~~n~l~~~~~~~~~~  183 (269)
                      +..+.++..++.+.           ...|.+ .+|++|++++|.+..+.+..+.... +|+.+++++|.++++++..|..
T Consensus        73 ~~~~~~~~~~~~l~~~~~~~~~~l~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~-~L~~l~l~~N~l~~i~~~~f~~  151 (284)
T d1ozna_          73 AAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLA-ALQYLYLQDNALQALPDDTFRD  151 (284)
T ss_dssp             TTTTTTCTTCCEEECCSCTTCCCCCTTTTTTCTTCCEEECTTSCCCCCCTTTTTTCT-TCCEEECCSSCCCCCCTTTTTT
T ss_pred             cccccccccccccccccccccccccchhhcccccCCEEecCCcccccccccccchhc-ccchhhhccccccccChhHhcc
Confidence            98888777665432           334444 3799999999999988888888887 8999999999999999888999


Q ss_pred             CCCCCEEeccCCCCCCCCCCcccCCCCCCEEEcCCCccccc-cccccCcCCCceeeeccCcccccc-------cccceee
Q psy10547        184 LKNLTLIDLSKNKIGKIPDDSFSTLNNLVTLKLSDNNLTLY-KNSFRGLELNNNLTLYKNSFRGLE-------LSLKNLN  255 (269)
Q Consensus       184 l~~L~~L~l~~n~i~~i~~~~~~~l~~L~~L~L~~n~l~~~-p~~~~~l~~L~~l~l~~n~~~~l~-------~~L~~L~  255 (269)
                      +++|+.|++++|.++.+++.+|.++++|+.+++++|+++.+ |..|..+++|+.|++++|.+.+++       ++|++|+
T Consensus       152 ~~~L~~L~l~~N~l~~l~~~~f~~l~~L~~l~l~~N~l~~i~~~~f~~l~~L~~L~l~~N~i~~~~~~~~~~~~~L~~L~  231 (284)
T d1ozna_         152 LGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLR  231 (284)
T ss_dssp             CTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSSCCSCCCHHHHTTCTTCCEEE
T ss_pred             ccchhhcccccCcccccchhhhccccccchhhhhhccccccChhHhhhhhhcccccccccccccccccccccccccCEEE
Confidence            99999999999999999988999999999999999999865 778999999999999999998865       5799999


Q ss_pred             cCCCCCCC
Q psy10547        256 LKNTKLKS  263 (269)
Q Consensus       256 l~~n~l~~  263 (269)
                      +++|++..
T Consensus       232 l~~N~l~C  239 (284)
T d1ozna_         232 LNDNPWVC  239 (284)
T ss_dssp             CCSSCEEC
T ss_pred             ecCCCCCC
Confidence            99998763



>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure