Diaphorina citri psyllid: psy10549


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MASLVSLSSTDAVKSSLVKSNGHRTSRDHLMTMDEKYVQDIWLLLKNAIQEIQKKNNSGLSFEELYRNAYTMVLHKHGERLYSGLKEVVTAHLETKVGVEPAT
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
*******************************TMDEKYVQDIWLLLKNAIQEIQKKNNSGLSFEELYRNAYTMVLHKHGERLYSGLKEVVTAHLETKVGV****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLVSLSSTDAVKSSLVKSNGHRTSRDHLMTMDEKYVQDIWLLLKNAIQEIQKKNNSGLSFEELYRNAYTMVLHKHGERLYSGLKEVVTAHLETKVGVEPAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cullin-3 Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the BCR complex depends on the BTB domain-containing protein as the susbstrate recognition component. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, H2AFY and DAXX, and probably GLI2 or GLI3. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B). BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; possibly by mediating ubiquitination of SLC12A3/NCC. Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition.confidentQ13618
Cullin-3 Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the BCR complex depends on the BTB domain-containing protein as the susbstrate recognition component. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, H2AFY and DAXX, and probably GLI2 or GLI3. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; possibly by mediating ubiquitination of SLC12A3/NCC. Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition (By similarity). BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B).confidentQ9JLV5
Cullin-3 Probable core component of cullin-based SCF-like E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit. Involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division.confidentA4IHP4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0031463 [CC]Cul3-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005827 [CC]polar microtubuleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0000922, GO:0044446, GO:0015630, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0005622, GO:0005874, GO:0043226, GO:0005876
GO:0006513 [BP]protein monoubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0008054 [BP]cyclin catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0016055 [BP]Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031208 [MF]POZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0043149 [BP]stress fiber assemblyprobableGO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0051017, GO:0016043, GO:0044085, GO:0044763, GO:0030036, GO:0008150, GO:0071840
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0044254 [BP]multicellular organismal protein catabolic processprobableGO:0044266, GO:0044238, GO:1901575, GO:0043170, GO:0008152, GO:0044707, GO:0071704, GO:0007586, GO:0044710, GO:0044268, GO:0044236, GO:0019538, GO:0032501, GO:0008150, GO:0030163, GO:0044259, GO:0044256, GO:0044243, GO:0009056, GO:0009057, GO:0044699
GO:0007229 [BP]integrin-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0035046 [BP]pronuclear migrationprobableGO:0044699, GO:0051656, GO:0000003, GO:0051234, GO:0040023, GO:0009987, GO:0009566, GO:0019953, GO:0008150, GO:0022414, GO:0044702, GO:0044763, GO:0007338, GO:0051649, GO:0051647, GO:0007097, GO:0051179, GO:0051640, GO:0051641
GO:0097193 [BP]intrinsic apoptotic signaling pathwayprobableGO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0097190, GO:0050794, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007569, GO:0050789, GO:0044699
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0001831 [BP]trophectodermal cellular morphogenesisprobableGO:0032502, GO:0030154, GO:0048468, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0001829, GO:0048869, GO:0001825, GO:0001824, GO:0016043, GO:0032989, GO:0071840, GO:0043009, GO:0048646, GO:0048598, GO:0032501, GO:0009987, GO:0044767, GO:0001701, GO:0044763, GO:0044707, GO:0048856, GO:0008150
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0007369 [BP]gastrulationprobableGO:0048598, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0040016 [BP]embryonic cleavageprobableGO:0032502, GO:0009987, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0032501, GO:0044763, GO:0044699, GO:0008150, GO:0007275, GO:0051301
GO:0000090 [BP]mitotic anaphaseprobableGO:0006996, GO:0044699, GO:0000279, GO:0000278, GO:0051322, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007067, GO:0007049, GO:0048285
GO:0045187 [BP]regulation of circadian sleep/wake cycle, sleepprobableGO:0050896, GO:0007623, GO:0007622, GO:0044708, GO:0042745, GO:0048583, GO:0048512, GO:0050795, GO:0048511, GO:0042752, GO:0065007, GO:0022410, GO:0051239, GO:0008150, GO:0007610, GO:0050789, GO:0042749
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0030431 [BP]sleepprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0035024 [BP]negative regulation of Rho protein signal transductionprobableGO:0051056, GO:0009968, GO:0050794, GO:0009966, GO:0048583, GO:0048585, GO:0023051, GO:0046578, GO:0051058, GO:0008150, GO:0023057, GO:0065007, GO:0046580, GO:0035023, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0010648
GO:0007423 [BP]sensory organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048208 [BP]COPII vesicle coatingprobableGO:0022607, GO:0070271, GO:0043933, GO:0006901, GO:0006900, GO:0006903, GO:0048207, GO:0061024, GO:0051656, GO:0051650, GO:0044699, GO:0006888, GO:0071822, GO:0016044, GO:0016043, GO:0065003, GO:0071840, GO:0051641, GO:0006810, GO:0048193, GO:0006461, GO:0048199, GO:0044765, GO:0044763, GO:0051648, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0016482, GO:0006996, GO:0090114, GO:0016192, GO:0046907, GO:0016050, GO:0044085, GO:0008150, GO:0009987
GO:0030332 [MF]cyclin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006919 [BP]activation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0097202, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0043280, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0007291 [BP]sperm individualizationprobableGO:0048610, GO:0048232, GO:0007286, GO:0048468, GO:0019953, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0000003, GO:0048869, GO:0007349, GO:0007276, GO:0030855, GO:0002064, GO:0048515, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0008150, GO:0022412, GO:0007281, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0048646, GO:0044763, GO:0009987
GO:0045475 [BP]locomotor rhythmprobableGO:0007626, GO:0007623, GO:0007622, GO:0044708, GO:0050896, GO:0007610, GO:0048511, GO:0048512, GO:0008150, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0017145 [BP]stem cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0051301
GO:0032467 [BP]positive regulation of cytokinesisprobableGO:0090068, GO:0051726, GO:0010564, GO:0050794, GO:0050789, GO:0048518, GO:0051781, GO:0065007, GO:0032465, GO:0008150, GO:0051302, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AP2, chain B
Confidence level:very confident
Coverage over the Query: 25-100
View the alignment between query and template
View the model in PyMOL