Diaphorina citri psyllid: psy1054


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
SLNPCCLLVVSGGCCGHTKKLTVVGGWAWAWWMVTDVQRISLEDVETLQGVPVTVTGTAQVKIMKAEELIQSASEQFLGKSKEEIQKTILHTLEGHLRAILGTLTVEEIVKDRDQFASLVREVAAPDVGRMGIEILSFTIGEEAECEKSAMDIKYATDSKIENNARLFKLQKASFDAEISTAFLNPCCLLVVSGGCCGHTKKLTVVGGWAWAWWMVTDVQRISLEDVETLQGVPVTVTGTAQVKIMKAEELIQSASEQFLGKSKEEIQKTILHTLEGHLRAILAPLAKTEEIVLLGGNDHVTNDITRLVAQLPPAVQALTGVDISKIQRREKELTATVKLPAEAECYRLETLAEAKKIQSIELAKAEAWKIKSQGLADATASEALGRAEADRMRLKAQVFKQYGDAAVMALVLDALPKIAAEVAAPLAKTEEIVLLGGNDHVTNDITRLVAQLPPAVQALTGVDISK
cccccEEEEEEccccccccCEEEEccEEEEEccccEEEEECcccccccccCEEEEEEEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHccEEEEEEEcccccccHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHcHHHHHHHccccccc
SLNPCCLLVVSGGCCGHTKKLTVVGGWAWAWWMVTDVQRISLEDVETLQGVPVTVTGTAQVKIMKAEELIQSASEQFLGKSKEEIQKTILHTLEGHLRAILGTLTVEEIVKDRDQFASLVREVAAPDVGRMGIEILSFTIGEEAECEKSAMDIKYATDSKIENNARLFKLQKASFDAEISTAFLNPCCLLVVSGGCCGHTKKLTVVGGWAWAWWMVTDVQRISLEDVETLQGVPVTVTGTAQVKIMKAEELIQSASE*FLGK**EEIQKTILHTLEGHLRAILAPLAKTEEIVLLGGNDHVTNDITRLVAQLPPAVQALTGVDISKIQRREKELTATVKLPAEAECYRLETLAEAKKIQSIELAKAEAWKIKSQGLADATASEALGRAEADRMRLKAQVFKQYGDAAVMALVLDALPKIAAEVAAPLAKTEEIVLLGGNDHVTNDITRLVAQLPPAVQALTGVD***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLNPCCLLVVSGGCCGHTKKLTVVGGWAWAWWMVTDVQRISLEDVETLQGVPVTVTGTAQVKIMKAEELIQSASEQFLGKSKEEIQKTILHTLEGHLRAILGTLTVEEIVKDRDQFASLVREVAAPDVGRMGIEILSFTIGEEAECEKSAMDIKYATDSKIENNARLFKLQKASFDAEISTAFLNPCCLLVVSGGCCGHTKKLTVVGGWAWAWWMVTDVQRISLEDVETLQGVPVTVTGTAQVKIMKAEELIQSASEQFLGKSKEEIQKTILHTLEGHLRAILAPLAKTEEIVLLGGNDHVTNDITRLVAQLPPAVQALTGVDISKIQRREKELTATVKLPAEAECYRLETLAEAKKIQSIELAKAEAWKIKSQGLADATASEALGRAEADRMRLKAQVFKQYGDAAVMALVLDALPKIAAEVAAPLAKTEEIVLLGGNDHVTNDITRLVAQLPPAVQALTGVDISK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flotillin-2 May play a role in axon growth and regeneration. May be involved in epidermal cell adhesion and epidermal structure and function.confidentQ9Z2S9
Flotillin-2a May play a role in axon growth and regeneration. May be involved in epidermal cell adhesion and epidermal structure and function.confidentQ98TZ8
Flotillin-2 May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function.confidentA6QLR4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WIN, chain A
Confidence level:very confident
Coverage over the Query: 33-156
View the alignment between query and template
View the model in PyMOL
Template: 1WIN, chain A
Confidence level:very confident
Coverage over the Query: 215-340
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 2-179
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 184-290
View the alignment between query and template
View the model in PyMOL