Diaphorina citri psyllid: psy10560


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MFHSGVCETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR
cccccccccccccccccccccccCEECcccccccccccccccccccccEECccEEEEccccccccccccccccc
****G**ETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQC***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFHSGVCETQRAAHTYAVSHSGHSEGIQDSEHTSLTQPLCDKDCGTHGHCVGDACVCNAGWSGEYCNLQQCDNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031005 [MF]filamin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FCS, chain B
Confidence level:confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL